(data stored in ACNUC7421 zone)

EMBL: CP001743.PE128

CP001743.PE128       Location/Qualifiers
FT   CDS_pept        complement(107966..108580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0130"
FT                   /product="single-stranded nucleic acid binding R3H domain
FT                   protein"
FT                   /note="PFAM: single-stranded nucleic acid binding R3H
FT                   domain protein; SMART: single-stranded nucleic acid binding
FT                   R3H domain protein; InterPro IPR001374; KEGG: scl:sce2518
FT                   RNA-binding protein; COGs: COG1847 RNA-binding protein;
FT                   SPTR: A7B003 Putative uncharacterized protein; PFAM: R3H
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26910"
FT                   /protein_id="ADD26910.1"
FT                   /translation="MDDKKRGLDDLLSDLGIGENETAPEVVLKEEEAAPIVTQPTPAQD
FT                   PKSVLEHFMVGLLLRLDPAYSVDIVQEENLFRVEILGGDSGRVIGREGKTLQSLEFIAN
FT                   VAMAKHFGSAYRVVLDAAGYRRRNEERIRRMAADAVLQVEVSGQPIELPPMRPSERRLI
FT                   HVMLKQHPKVTTTSVGEGEARHVVVLPRTATPPASPENDLE"
     atggatgaca aaaagcgcgg actcgacgat ctgttatccg acctggggat tggggaaaac        60
     gaaaccgccc ccgaggtcgt gcttaaggag gaggaggcag cccccatcgt gacccagccc       120
     accccagcac aagaccccaa gagtgtcctc gagcacttca tggtggggct cttgttgcgc       180
     ctcgacccgg cctactcggt ggatattgtt caggaggaga acctgtttcg cgtcgagatt       240
     ctggggggcg actcggggcg ggtgatcggg cgcgagggca aaaccctgca aagcctcgag       300
     tttatcgcca acgtagccat ggctaaacac ttcggctcgg cctaccgggt ggtgctggac       360
     gcggccggtt accgccgccg caacgaggag cgcatccggc ggatggccgc ggacgcggtg       420
     ttgcaggtgg aggtgagcgg ccagcccatc gaactccccc ccatgcgccc cagcgaacgg       480
     cgcttgattc acgtgatgct caagcagcac cccaaagtga ccaccacctc ggtaggcgag       540
     ggagaggcac gccacgtggt ggttctgccc cgcacagcca cccctcctgc ctcccctgag       600
     aatgacctcg agtaa                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page