(data stored in ACNUC7421 zone)

EMBL: CP001743.PE129

CP001743.PE129       Location/Qualifiers
FT   CDS_pept        complement(108966..110345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0131"
FT                   /product="60 kDa inner membrane insertion protein"
FT                   /note="PFAM: 60 kDa inner membrane insertion protein; SPTR:
FT                   Q9RSH5 Membrane protein oxaA; InterPro IPR001708; COGs:
FT                   COG0706 Preprotein translocase subunit YidC; KEGG:
FT                   sat:SYN_01014 60 kDa inner membrane protein; PFAM: 60Kd
FT                   inner membrane protein; TIGRFAM: membrane protein
FT                   insertase, YidC/Oxa1 family, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26911"
FT                   /protein_id="ADD26911.1"
FT                   /translation="MKRWFWISLAVFALAPALALSPEWRDVDVNKDGKPEKVAVTNLAD
FT                   IAFNEQGQIVGWYIKTVRATDFKGNYERAPNLVRAGQTPPGTLEGFTPTSREFTRREQG
FT                   NPDADFIARFSDGSTTLTYTIHPRFLTIDVDVQSPTPRKLVWTGIGGTDTPITKWLGQG
FT                   NNQPLNAGQGPAVYVGWQTHKASGFAMFIRPQTPTPITLTQLNGAGIAEISVPAGSLNL
FT                   KVYGGANELVRLSVENFYELPGVFQPNIWGQISLGLLWLLEEAHRLVGGSWVLAIVLVT
FT                   ILIRLLMWPLMHQQYKSMAEMQKIQPLLKKIQEKYKDNKEKQQEEMMKLYQEHKINPLG
FT                   GCFPLLLQMPILFLMYKIMVGYEFGQGFLWIPDLALPDPIYVLPLIYIAVIFISTLLTS
FT                   AGNKDAIRQGIIFNLVFAFILFSFPAGVNLYYTFFTILGIGQQFYINKQLGISKPSMLA
FT                   K"
     atgaaacgtt ggttctggat aagtttggct gtgtttgccc tggcccccgc cctggcccta        60
     tcccccgaat ggcgcgatgt ggacgtaaac aaagacggca agcccgaaaa ggtggccgtc       120
     accaacctgg ccgacatcgc ctttaacgaa caggggcaga ttgtgggctg gtacatcaaa       180
     accgtgcgcg ccaccgactt taagggcaac tacgagcgcg cccccaacct ggtacgggcc       240
     ggacagaccc cgcccggaac cctcgagggc ttcaccccca ccagccgcga gtttacccgc       300
     cgggagcagg gcaaccccga cgccgacttc atcgcccgct ttagcgacgg cagcaccacc       360
     ctgacctaca ccatccaccc ccgcttcctg accatagacg tagacgtgca aagccccacc       420
     ccgcgcaagc tggtctggac gggcatcggc ggcaccgaca cccccatcac caagtggctg       480
     gggcagggca acaaccagcc cctcaatgcg gggcagggcc cggcggtgta tgtgggctgg       540
     cagacccata aggcttcggg cttcgccatg tttattcgcc cgcaaacccc cacccccatc       600
     accctcaccc aactcaacgg ggctgggatt gccgaaatta gcgttccagc aggcagcctc       660
     aaccttaagg tgtacggcgg ggccaacgag ctggtgcgcc tgagcgtgga gaacttctac       720
     gagctgccgg gggttttcca gcccaacatc tggggccaaa tttcgctggg cctgctgtgg       780
     ctgctggagg aagcccaccg cctggtaggg ggtagctggg tgctggccat tgtgttggtg       840
     accatcctga tccggctctt gatgtggccc ctgatgcacc agcagtacaa gagcatggcc       900
     gaaatgcaaa aaatccagcc cctgctcaag aaaattcagg aaaagtacaa agacaacaaa       960
     gaaaagcagc aggaagagat gatgaagctc taccaggagc acaagataaa ccccctgggc      1020
     ggctgctttc ccttgctgct ccagatgccc attttgttcc tgatgtacaa gattatggtg      1080
     ggctacgagt tcgggcaggg ctttttgtgg attcctgact tggccctacc cgatccgatt      1140
     tatgttttgc cgctaattta catagcggtt atcttcatct caaccttgct gacatctgct      1200
     ggaaacaaag acgctattag gcaaggtatc atcttcaatc tagtatttgc tttcatcctc      1260
     tttagctttc ctgcaggagt aaacctgtac tacacttttt ttactatatt aggtattggt      1320
     caacagtttt atatcaataa acagcttggc atcagcaagc catccatgct cgccaaataa      1380
//

If you have problems or comments...

PBIL Back to PBIL home page