(data stored in ACNUC7421 zone)

EMBL: CP001743.PE131

CP001743.PE131       Location/Qualifiers
FT   CDS_pept        complement(110661..110993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0133"
FT                   /product="ribonuclease P protein component"
FT                   /note="TIGRFAM: ribonuclease P protein component; PFAM:
FT                   ribonuclease P protein; InterPro IPR000100; KEGG:
FT                   azo:azo3991 ribonuclease P; COGs: COG0594 RNase P protein
FT                   component; SPTR: Q7X5K8 Ribonuclease P protein component;
FT                   PFAM: Ribonuclease P; TIGRFAM: ribonuclease P protein
FT                   component, eubacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26913"
FT                   /protein_id="ADD26913.1"
FT                   /translation="MPFSSLKGEKAFQRLRGGRVGRGKYLTVRWFPLRPTAFNPVRVGI
FT                   VVSNKVSKKATVRNKIRRRLREILRKMHLPPCEMVVVAQPEAVEASYWDLLKDLTHALK
FT                   KSGLVQ"
     atgccgttct cttccctcaa gggtgaaaaa gccttccagc gccttcgggg ggggcgtgtg        60
     gggcgtggga agtatctgac ggtgcgctgg tttccgctgc ggcccaccgc cttcaacccg       120
     gtgcgggtgg gtattgtggt ctcgaataag gtctctaaaa aggccaccgt gcggaacaaa       180
     attcggcgtc gcctgcgaga aattctgcga aaaatgcatc ttccgccgtg tgagatggtg       240
     gtcgtggccc agcccgaggc ggtagaggcg tcgtactggg acttgctcaa ggatttaacc       300
     catgccctaa aaaagagcgg gctggtacaa tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page