(data stored in ACNUC7421 zone)

EMBL: CP001743.PE133

CP001743.PE133       Location/Qualifiers
FT   CDS_pept        111525..112292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0135"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   InterPro IPR003439:IPR003593; KEGG: met:M446_2309 ABC
FT                   transporter related; COGs: COG0411 ABC-type branched-chain
FT                   amino acid transport systems ATPase component; SPTR: A0NNM9
FT                   ABC branched amino acid transporter family, ATPase subunit;
FT                   PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26915"
FT                   /protein_id="ADD26915.1"
FT                   /translation="MQLKVERVSLNFGGVKALSEVSLEVAQGELVSVIGPNGAGKTSLL
FT                   NCISGFYHPSAGKITFEGHDLTHASPHQVTKFGIARAFQNIELFTGMSVLENLLMARHT
FT                   FGHYNLLDNILIYGRAMRVGVENRRFCEEIIDFMELEPYRKALVGDLPYGVRKRVEVAR
FT                   ALALSPKLLLLDEPMAGMTLEEKEDMVRFILDIRAERGTTIILIEHDLGVVMDISDRVY
FT                   VLDFGQVIASGLPEEVSQNPRVQEAYVGVDHAV"
     gtgcagctca aggtagaacg tgtttctcta aacttcggcg gggtcaaggc gctgagcgag        60
     gtttccctcg aggtcgccca gggtgagctg gtctcggtga tcggccccaa cggggcgggc       120
     aagaccagcc tgcttaactg catctccggc ttctaccacc ccagcgcggg caagattacc       180
     ttcgagggcc acgatctgac ccacgcctcg ccccaccagg tcactaaatt tggtatcgcc       240
     cgggctttcc aaaatatcga attgttcacc ggcatgtcgg tgctggagaa cctcctgatg       300
     gcccgccaca cctttggtca ttacaacctg ctggacaaca tcctgatcta tggccgggcc       360
     atgcgggtgg gcgtggagaa ccgccgcttt tgcgaggaga tcatagactt catggagctc       420
     gagccctacc gcaaagccct ggtaggcgac ctgccctacg gggtgcgcaa gcgggtggag       480
     gtggcccgcg cgctggccct ctcgcccaag ctcttgctgc tggacgagcc catggccggc       540
     atgaccctgg aagaaaaaga agacatggtg cgcttcatcc tggatatccg ggccgaacgg       600
     ggcaccacca tcatcctcat cgagcacgat ctgggcgtgg tcatggacat ctccgaccgg       660
     gtctatgtgc tggacttcgg ccaggtcatc gcttccggcc tgcccgagga agtcagccag       720
     aacccgcggg tacaggaggc ctatgtgggg gtggatcatg cggtgtga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page