(data stored in ACNUC7421 zone)

EMBL: CP001743.PE136

CP001743.PE136       Location/Qualifiers
FT   CDS_pept        115246..116322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0138"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; SPTR: A6EZ42
FT                   Inner-membrane translocator; InterPro IPR001851; COGs:
FT                   COG4177 ABC-type branched-chain amino acid transport system
FT                   permease component; KEGG: bpt:Bpet1128 high-affinity
FT                   branched-chain amino acid transport system permease
FT                   protein; PFAM: Branched-chain amino acid transport system /
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26918"
FT                   /protein_id="ADD26918.1"
FT                   /translation="MRNPWAQTGNYRTSYVQDTTIFANYREIVSVVLLLVGLCILPLFL
FT                   ERSQVLVLNFILIYAIAVLGLNITTGYAGLISVGQAAFMGVGAYTVALSAPSLPFWLTI
FT                   PLGGFTAAIIGFIVGIPSLRVKHLYLVLATLAFQEIFVWVVGRSPALAQGAAIPVEMRN
FT                   FLGLEIGFRNHNYFWYYVILFVLVLMVMAWRNLLRGKYGRALIAVRDNDRAADAMGMDP
FT                   GRTKLMAFALGAFYGGVAGGLLAYMQRAVVVEEFTLSRSVALLAMAIVGGLGTVVGSLL
FT                   GPAFIEFLRLYVERLSEWMKSNAFIQSITPAGVDVASALLPLSFGLVIVLFLIFEPRGL
FT                   YNWWRLLRSYFRTWPFRY"
     atgcgtaacc cctgggccca gaccggcaac taccgcacct cctacgtgca ggacaccacc        60
     atctttgcca attaccgcga gattgtctcg gtggtgctgc ttttggtggg gctgtgcatt       120
     ctgccgctgt ttctcgagcg ctcgcaggtg ttggtgctca actttatcct gatttatgcc       180
     attgcagtgc tggggcttaa catcaccacc ggatacgcgg gcctgatcag cgtggggcag       240
     gcggccttta tgggggtggg ggcttatacg gtggccttaa gcgcacccag cctacccttc       300
     tggctgacca ttcccctggg gggctttacg gcggccatca tcgggttcat tgtggggatt       360
     cccagcctcc gggtcaaaca cctctatctg gtgctggcta cgctggcttt tcaggagatt       420
     ttcgtctggg tggtggggcg cagcccggcc ctggcccagg gggcggccat tccagtggag       480
     atgcgcaact ttttgggcct ggaaatcggt ttccgcaacc acaactactt ctggtattac       540
     gtcatcctgt ttgtgctggt gctgatggtg atggcctggc gcaacctctt gcggggcaag       600
     tatggccgcg cccttatcgc cgtgcgcgac aacgaccgcg cggcggatgc catgggcatg       660
     gatccgggcc gtaccaagct gatggccttt gccctggggg ccttttatgg cggggtggcc       720
     gggggcttgc tggcctatat gcagcgggcg gtggtggtgg aggagtttac cctaagccgc       780
     tcggtggcgc tcctggctat ggccatcgtg ggcggcctgg gcacggtggt gggcagccta       840
     ctgggcccgg cctttatcga gttcctgcgg ctttacgtgg agcgcctctc cgaatggatg       900
     aagtccaacg ccttcatcca gagcatcacc ccggctggtg tggatgtggc ctcggccctg       960
     ctaccccttt ccttcggttt ggtgattgtg ctgtttttga tctttgagcc gaggggcctc      1020
     tacaactggt ggcggctttt acgaagttat ttccgaacgt ggccgttcag atactag         1077
//

If you have problems or comments...

PBIL Back to PBIL home page