(data stored in ACNUC7421 zone)

EMBL: CP001743.PE137

CP001743.PE137       Location/Qualifiers
FT   CDS_pept        116388..117596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0139"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems periplasmic component"
FT                   /note="SPTR: A6EZ41 Extracellular ligand-binding receptor;
FT                   COGs: COG0683 ABC-type branched-chain amino acid transport
FT                   systems periplasmic component; KEGG: rfr:Rfer_4065
FT                   extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26919"
FT                   /protein_id="ADD26919.1"
FT                   /translation="MKRAMILATMAFLGLAMAQGRTVNLLWSGAVTGPTSDVGGPYGAG
FT                   VEDYCRYANEQKLIPNVTLNCTVRDDQYQNPNTQRIFEEALDRAKPAIYLGYSTGAMLQ
FT                   LKPLINEVKMPTIPASAHIGLIDPPNNQYMFLPVSSYSEQVVALMEYINRTTKNAKIAL
FT                   VINPSPFGRAVVDHARRAAQRLGQTIVDVREVGSGNLDNTALLRALDAAGAQFIIHQNV
FT                   AGPVANILKDAQRLGLNRKIRQMGAVYTGGSDLIRLAGEAAEGFLWASSYYTLDENAPG
FT                   INLQKQLAQKYNRSADILNSTNYTAGMLAAAIAVEAMRRAGQRFNGRIDNETVYQALIG
FT                   MNGPNAFKPGFAVSTKAGIEIDFTRSEQTGAEGLRVLEARGGKFVPVTEPFTSALFRQV
FT                   RNP"
     atgaagcgag cgatgatttt ggcgacaatg gccttcctgg ggctggctat ggcccagggg        60
     cgcacggtaa acctgctgtg gtcgggggcc gtgaccggcc cgacctcaga tgtgggaggg       120
     ccttacgggg cgggtgtgga ggactactgc aggtacgcca acgagcaaaa gctgatcccc       180
     aacgtaaccc tgaactgcac ggtgcgcgac gaccagtacc agaaccccaa cacccagcgc       240
     atctttgagg aagccctgga tcgggccaag ccagctattt acctgggcta ctccaccggg       300
     gccatgctgc aactcaagcc cctcatcaac gaggtgaaga tgcccaccat tccggcctcg       360
     gcccacatcg ggctgattga cccacccaac aaccagtaca tgttcctgcc ggtgagcagc       420
     tactccgagc aggtggtggc tttgatggag tacatcaacc gcaccaccaa gaacgccaag       480
     attgccctgg tgattaaccc cagccccttt gggcgggcgg tggtggatca tgcccgccgg       540
     gctgctcagc ggctggggca gaccatcgtg gatgtgcggg aagtggggag tggcaacctg       600
     gacaacaccg cgctgctgcg ggccctggat gcggcagggg cgcagtttat catccaccag       660
     aacgtagccg ggccggtggc caatatcctc aaagacgccc agcgcctggg tttgaaccgc       720
     aagattcgtc agatgggggc ggtgtacacc ggtggctcgg atctgatccg cctggcgggg       780
     gaggccgctg agggtttctt gtgggccagc agctactata ccctggacga gaacgccccg       840
     ggcatcaacc tgcaaaaaca actggcccag aaatacaacc gcagcgccga catcctcaac       900
     tccaccaact acaccgccgg gatgctggcg gcggccatcg cggtggaggc catgcgccgg       960
     gccgggcagc gttttaatgg gcgcattgac aacgagaccg tctatcaggc cctgattggt      1020
     atgaacggcc ccaacgcctt taagcctggt tttgcagttt ccaccaaggc cggtatcgag      1080
     attgacttta cccgcagcga gcaaaccggc gccgagggcc tgcgggtgct ggaggccagg      1140
     ggcggtaaat ttgtgccggt aaccgagccc ttcacttcag cgctcttccg gcaggtgcgg      1200
     aacccctaa                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page