(data stored in ACNUC7421 zone)

EMBL: CP001743.PE138

CP001743.PE138       Location/Qualifiers
FT   CDS_pept        117668..118486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0140"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   InterPro IPR003439:IPR003593:IPR017871; KEGG: mag:amb3593
FT                   ABC-type branched-chain amino acid transport systems,
FT                   ATPase component; COGs: COG0410 ABC-type branched-chain
FT                   amino acid transport systems ATPase component; SPTR: A4TXT0
FT                   Branched chain amino acid ABC transporter, ATP-binding
FT                   protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26920"
FT                   /protein_id="ADD26920.1"
FT                   /translation="MRPEDLGNILLEVNNIEVVYKDIIQVLRGVSLKVPEGQITALLGP
FT                   NGAGKTTTLRAISGLLVPEDGKVVSGSILYRGENIANKPPEQIVLKGIVQVPEGRRVFK
FT                   HLTVEENLRVGAVTRRDGAKVREDLERIYHYFPKLALIRTRLAGYCSGGEQQMLAIGRA
FT                   LLANPKLLLLDEPSLGLAPLLVREIFDIVAQINAEEGVTVLVVEQNARVALSVAHYGYI
FT                   MESGRIALEGTREYLETNPDVKEFYLGVAKSGGRKSFKDVKSYRRRKRFM"
     atgcgccccg aagaccttgg gaacatcctg ctggaagtca acaacattga ggtggtgtac        60
     aaggacatca tccaggtgct gcgcggggta tcgctgaagg tgcccgaagg gcagatcacc       120
     gccttgctgg gccccaacgg agctgggaaa accaccacct tgcgggccat ctcggggttg       180
     ctggtgcccg aggacggcaa ggtggtctcg ggctccattc tgtaccgggg tgaaaacatc       240
     gccaacaagc cgcccgagca gattgtgctg aagggcattg tgcaggtgcc ggaggggcgg       300
     cgggtgttca agcacctcac cgttgaggag aacctgcggg tgggtgcggt gacccggcgg       360
     gatggggcca aggtaagaga ggatctcgag cgcatctacc actacttccc caagctggcg       420
     ctgatcagaa cccgcctggc tggctactgc tcgggggggg agcagcagat gctggccatt       480
     gggcgggccc tgctggccaa ccccaagctc ttgctgctgg acgagccaag tttgggtctg       540
     gcccccctgc tggtacggga aatttttgac attgtggccc agatcaacgc cgaggagggc       600
     gtgacggtgt tggtggtgga acaaaacgct cgagtagccc tttcggtggc ccattatggc       660
     tacatcatgg agtcgggccg gattgccctc gagggcacca gggaatacct ggaaaccaac       720
     cctgatgtaa aggagttcta cttgggtgta gccaagtcgg gcgggcgcaa gagcttcaag       780
     gacgtcaaaa gctaccgccg gcgcaagcgc tttatgtga                              819
//

If you have problems or comments...

PBIL Back to PBIL home page