(data stored in ACNUC7421 zone)

EMBL: CP001743.PE140

CP001743.PE140       Location/Qualifiers
FT   CDS_pept        complement(119005..119424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26922"
FT                   /protein_id="ADD26922.1"
FT                   /translation="MVAMEIVGLRGAPQETLRALKEALKGVSFPEALAIYITDWQDQRA
FT                   QARFALFVRQGKHRVLSRDAFGPRFGLEGDAALKDLTLWLIERGVTDFKEAVVAPSEFA
FT                   ALFELEAEEAQKLIMASANPTDPMLYIKREFTSRM"
     atggtggcta tggaaattgt tggccttcgc ggcgcgcccc aagaaaccct tcgagccctc        60
     aaggaagccc tgaagggcgt tagtttcccc gaggccctgg cgatctatat caccgactgg       120
     caggatcagc gagcccaggc ccgctttgcc ctctttgtgc ggcagggcaa gcaccgcgtc       180
     ttgagccggg atgccttcgg cccgcggttt ggcctcgagg gcgacgcagc gctcaaagac       240
     ctcaccctct ggctgatcga acggggcgtg accgatttca aagaagccgt ggtagccccc       300
     tcggagttcg cggcgttgtt tgagctcgag gcggaagaag cccagaagct gattatggcc       360
     agcgccaacc ccaccgaccc catgctctac atcaaacggg aattcaccag ccggatgtaa       420
//

If you have problems or comments...

PBIL Back to PBIL home page