(data stored in ACNUC7421 zone)

EMBL: CP001743.PE147

CP001743.PE147       Location/Qualifiers
FT   CDS_pept        127455..128486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0149"
FT                   /product="ABC transporter related protein"
FT                   /EC_number="7.2.2.7"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; InterPro
FT                   IPR003439:IPR013611:IPR003593:IPR017871; KEGG:
FT                   pen:PSEEN1241 ABC transporter, ATP-binding protein; COGs:
FT                   COG3842 ABC-type spermidine/putrescine transport systems
FT                   ATPase components; SPTR: P77795 Uncharacterized ABC
FT                   transporter ATP-binding protein ydcT; PFAM: ABC
FT                   transporter; TOBE domain; TIGRFAM: spermidine/putrescine
FT                   ABC transporter ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26929"
FT                   /protein_id="ADD26929.1"
FT                   /translation="MVQMYKEPETQSVQAAVELRGVSCYFGPVKAVDGVDLEILPGEFF
FT                   SMLGPSGSGKTTCLRLIGGFEQPTAGQIVLFGQDASKLPPYARDVNTVFQDYALFPHMN
FT                   VRDNVAYALMVRGVPKPERHRRAEEMLELVKLSGLGDRRPGQLSGGQRQRVALARALIN
FT                   RPRLLLLDEPLGALDLKLREEMQIELKALQRQLGITFIYVTHDQGEALSMSDRVAVFNH
FT                   GKIEQLDNPKTLYEYPKTEFVARFVGSANVLEGRLLGLGTGKYALRPERIAIQAGSHNG
FT                   PNSLCGTLLDIHYLGAQTRYEVQVGNERLTVLTSSEEQGLQVGGAVTLRWEHSALRPLQ
FT                   EVS"
     atggtacaga tgtataaaga acccgaaacc caatccgttc aggctgccgt ggagctacgc        60
     ggggtgtcgt gttacttcgg cccggtgaag gcggtggacg gggtggactt ggaaatcttg       120
     cccggcgagt tcttctccat gctggggccc tcgggctcgg gcaaaaccac ctgcctgcgc       180
     ctgatcggcg gcttcgagca acccaccgcg gggcagattg tgctgtttgg gcaggacgct       240
     tccaagctgc cgccctatgc ccgcgacgtc aacacggtct ttcaggacta cgcgctcttt       300
     ccccatatga acgtgcgcga caacgtggcc tatgcgctga tggtgcgagg ggttcccaaa       360
     cctgagcgtc accggcgggc cgaggagatg ctggaactag tgaagctctc ggggctgggg       420
     gatcggcggc ctgggcagct ttcgggtggg cagcggcagc gggtggcgct ggctcgagcc       480
     ctcatcaacc ggcccaggct cctgctcctg gacgagcccc tgggggccct ggacctgaag       540
     ctgcgcgagg agatgcagat cgaactcaag gccctgcagc gccagctcgg tatcaccttc       600
     atctacgtga cccacgacca gggcgaagcc ctctcgatgt cggatcgggt cgcggtgttt       660
     aatcacggca aaatcgagca gctcgacaac cccaagaccc tctacgagta ccccaaaacc       720
     gagtttgtgg cccgctttgt ggggagtgcc aacgtgctcg agggccgcct gctggggctt       780
     ggaaccggca aatacgccct gcgcccggag cgcatcgcca tccaggcggg aagccacaat       840
     gggcccaaca gcctctgcgg caccttgctg gacattcact acctgggcgc acagacccgg       900
     tacgaggttc aggttggcaa cgagcggctc acggtgctca cctcatcgga agagcagggc       960
     ttgcaggtgg gcggtgccgt taccctgcgc tgggagcaca gtgcactgcg gcccctgcag      1020
     gaggtctcat ga                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page