(data stored in ACNUC7421 zone)

EMBL: CP001743.PE148

CP001743.PE148       Location/Qualifiers
FT   CDS_pept        128483..129406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0150"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: P77156 Inner membrane ABC
FT                   transporter permease protein ydcU; InterPro IPR000515;
FT                   COGs: COG1176 ABC-type spermidine/putrescine transport
FT                   system permease component I; KEGG: rlt:Rleg2_3425
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26930"
FT                   /protein_id="ADD26930.1"
FT                   /translation="MSGMTLRRRLSDALYVRPLLLLLLLLIPPLLWLGIIYLGSLFNLM
FT                   LYSFYSLNDFTGQVEYKFSLSAFQQLFSSPANVDIVLRTTLMALAVTLACAAIGFPIAY
FT                   YIAFYTQGTARTFWYLMVLLPLWSSYLVKVYAWRLILAGEGVVSWFFNLLGLGWLLQGI
FT                   LGLPVIGGPSLSNSYLGMFLVFTYIWLPYMILPIIAALERVPRSLIQASADLGARPGQT
FT                   FRKVIWPLVIPGVAAGSIFTFSLTLGDYIIPQVVGQPGFFIGQMVYVQQGTAGNLPLAA
FT                   AFSVVPVVIIAIYLLIVRRLGAFNAL"
     atgagcggta tgaccctgcg ccgtcgcctt tccgatgcgc tctatgtgcg cccgctgctg        60
     ctgttgttgc tgctgctgat accacctttg ctatggctgg gcatcatcta cctgggttcg       120
     ctttttaacc tgatgctcta cagcttttac tccctcaacg actttaccgg gcaggtggaa       180
     tataagtttt cactctcggc ttttcaacaa ttgtttagct ccccggccaa cgtagacatc       240
     gtgctacgca ccaccctgat ggccctggcg gtcacgctgg cctgcgcggc cattggcttt       300
     cccattgcct actacatcgc cttttatacc cagggcacgg cccgaacctt ctggtatctg       360
     atggtgttgc tgccgctgtg gtcgagctac ctggtcaagg tgtatgcctg gcgcctgatt       420
     ctggcgggcg agggggtggt gagctggttt ttcaacctgt tggggctggg ctggcttttg       480
     caaggcatcc tgggcctgcc ggtgatcggt ggccccagcc tgtccaacag ttacctgggt       540
     atgtttctgg tctttaccta catctggctt ccctacatga ttctgcccat catcgcggcc       600
     ctcgagcgcg tcccccgctc gctcatccag gcctcggccg acctgggggc ccggcccggc       660
     cagacctttc gcaaggtgat ctggccgttg gtgataccgg gggtggcggc aggctccatc       720
     ttcaccttct cactaaccct gggcgattac atcattccgc aggtggtggg gcagccgggc       780
     ttttttatcg gacagatggt ctatgtgcag cagggcaccg cgggcaattt gccgctggcg       840
     gcggccttct cggtggtgcc ggtggtgatc atcgccatct acctgctcat cgtgcggcgg       900
     ctgggggctt tcaatgcgct gtaa                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page