(data stored in ACNUC7421 zone)

EMBL: CP001743.PE153

CP001743.PE153       Location/Qualifiers
FT   CDS_pept        134129..135727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26935"
FT                   /protein_id="ADD26935.1"
FT                   /translation="MKVSAGGVSLQEAKTYKFASEIVYDLSLKPLHHLLLVGPETTDFW
FT                   GTIANPGDKNYALYAVGATDKRSFFSFIIPAGSFKSLAETRAKAGSFRRFLSPSVGVLY
FT                   LEDNTGRVWDVNTATEVGAEQMKVWRQAQRVLFEQRQKDGILDKIKEDWDRLRTEASQK
FT                   GLAQSGGLPTLDEVTLPNGHLDVPKLITALEAQKAAKGVSANYTNERAWCMGWFCAGMG
FT                   YASVVRKNRYNGDLANNNLYNPDNPQDYSDCNISGQKCRIANDIHNADPLGNLQWINYY
FT                   RYAPADGYWGAWDAGLSGLGRLNNIGCGPLAITRLFAWYATERQNYGSYNVNFINSGTA
FT                   PSTAYVIAQEMFEPVYLGTRDGQNVYQPRIARYTDTWWFQNSDQGLTRDTNMIPGANNW
FT                   IRDRASAEGKNWEMRGSHKAWVNIVYAATGWTVVAIPIAWIDFSQHTWRVRDIARGKIG
FT                   RDNEPVIAMYGQGTLGHFAMSQAYIVHEGWFSANLFLWIRREANSWAQDLLQGGFVNVT
FT                   DMASYYSGAFGMYRR"
     atgaaggttt ctgctggcgg ggtcagcttg caggaagcta agacctacaa atttgccagt        60
     gaaatcgttt atgacctatc cctcaaacct ttgcatcacc tgttgttggt ggggccagaa       120
     accaccgatt tttggggcac catagccaac cccggagata aaaactacgc gctctatgcg       180
     gttggcgcga cagataagcg tagcttcttc tcgttcatca ttcctgcggg cagcttcaag       240
     agcctggccg aaacacgggc caaagcaggc tcgttcaggc gcttcttgag tccttcggtt       300
     ggggtgctgt acctggaaga caacacaggg cgggtttggg atgttaacac cgcaacagaa       360
     gtgggcgccg agcaaatgaa ggtgtggcgt caagcccagc gtgtgctgtt tgagcagcgg       420
     caaaaggacg gtatcttgga caaaatcaag gaagactggg acagactgcg cactgaggcc       480
     agccagaagg gcctggctca aagcgggggg ctccccactc tagacgaagt gaccctgccc       540
     aacggccacc tggatgtacc taaactgatc actgcactgg aagcccagaa agctgccaaa       600
     ggggttagcg ccaactacac caacgagcgg gcctggtgca tgggctggtt ctgtgcgggt       660
     atgggttatg ccagcgtggt gcgcaagaac cgctacaacg gtgacttggc gaataacaac       720
     ctctacaatc cggataaccc ccaagactac agtgactgca acatcagcgg gcaaaaatgc       780
     cgtattgcca acgacataca taatgccgat ccgcttggga acctacaatg gatcaactat       840
     taccggtatg ctcccgccga cggttactgg ggagcatggg atgctggtct cagcggacta       900
     ggacgtctaa acaacattgg ttgtgggccg cttgcaataa cccggttgtt tgcctggtac       960
     gctactgagc gtcagaacta cggttcatat aacgtaaact ttattaactc cggcaccgcg      1020
     cccagtaccg cctatgtcat tgcgcaggaa atgtttgaac ccgtctacct tggtacacga      1080
     gacggtcaaa atgtctatca gccacggatt gctcgctaca ccgatacctg gtggtttcag      1140
     aactcagatc aaggtcttac ccgagacacc aacatgatcc caggtgcaaa caactggatt      1200
     cgggataggg cgagtgcgga agggaaaaac tgggagatgc gggggagcca caaagcctgg      1260
     gtgaatatag tctacgcggc cacgggatgg actgttgtgg caattcccat cgcatggata      1320
     gacttcagtc aacacacctg gcgcgtgcgc gatatagcgc gtggcaagat tgggcgagac      1380
     aatgagccgg tgattgcgat gtacgggcag ggcactttag gccactttgc tatgtcccag      1440
     gcttatattg tgcacgaggg ctggttctcg gccaatctgt ttctttggat taggagggaa      1500
     gcaaactcct gggcgcaaga tttgttgcaa ggtggtttcg tcaacgttac cgacatggcc      1560
     agctactaca gtggggcatt tggcatgtat aggagatag                             1599
//

If you have problems or comments...

PBIL Back to PBIL home page