(data stored in ACNUC7421 zone)

EMBL: CP001743.PE156

CP001743.PE156       Location/Qualifiers
FT   CDS_pept        complement(137628..138059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0158"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; InterPro
FT                   IPR000182; KEGG: ccs:CCNA_03676 GNAT acetyltranferase
FT                   protein; SPTR: P50858 Aminoglycoside
FT                   N(6')-acetyltransferase type 1; PFAM: Acetyltransferase
FT                   (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26938"
FT                   /protein_id="ADD26938.1"
FT                   /translation="MTIRPLQPQDLPAYFVLRTALWPDSAADFELEVSKILNHPHLASF
FT                   VAEQKGRLAGFVEVSLREYAEGCDSSPVGYLEGWYVAPKHRKTGIGRRLVQAAEDWARA
FT                   KGCSEMASDSELSNTPSHQAHARLGYQEVERTVCFRKSL"
     atgaccatcc gcccattaca accccaagac ctgcccgcct actttgtcct ccgcacggcc        60
     ctgtggcccg acagcgcagc cgacttcgag ctcgaggtaa gcaaaatcct gaaccaccct       120
     cacctcgcca gctttgtggc cgagcaaaag gggcggcttg ctggctttgt ggaggtttcg       180
     ctccgcgagt atgccgaggg ttgcgacagc agcccggtgg gctatctgga aggctggtac       240
     gtcgcgccaa agcaccgcaa aaccggcatt gggcgccggc tggtgcaggc cgccgaagac       300
     tgggccaggg caaaaggctg tagcgagatg gcctccgaca gcgagctatc caacacccca       360
     agccaccagg cccacgcgcg cctgggctac caggaagtag agcgcacggt ctgttttcgc       420
     aaatcgctgt aa                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page