(data stored in ACNUC7421 zone)

EMBL: CP001743.PE160

CP001743.PE160       Location/Qualifiers
FT   CDS_pept        complement(142126..142986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0162"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: P94312 Dipeptide transport
FT                   system permease protein dppC; InterPro IPR000515; COGs:
FT                   COG1173 ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems permease components; KEGG: bpt:Bpet2850 ABC
FT                   transporter inner membrane protein; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26942"
FT                   /protein_id="ADD26942.1"
FT                   /translation="MTTASPNSHLALVIRALLRNRSAVIGGLITLVVLLGALLAPILAP
FT                   WDPLKFDPPNRLSGPSSEHWLGTDQYGRDLLSRVLYGARFSLSVAAVSVLAGLLVGGTL
FT                   GLLAGYFRGWLDLVISRLADILIAYPAILLAIAFLAFLGGGFINLVLAISVVFVGPFIR
FT                   VARAAVLTVREELYVEAGRAMGASDARMIFRTILPNAAAPLIVEVTLRFAYAVLAEAAL
FT                   SFLGLGIQPPFPALGSMVSEGRAFLSLSPWGSLVPGCAIVLMVLGFNLLGDGLRDALDP
FT                   RLQKA"
     atgaccactg cttcccccaa ctcccatctg gccctggtca tccgggccct gctgcgcaac        60
     cgctctgccg tcattggcgg cctcatcacc ctggtggtgc tgctgggcgc gctcctggcc       120
     cccatcctag ccccctggga tcccctcaag ttcgaccccc ccaaccgcct cagcggcccc       180
     tcctccgagc actggctggg caccgaccag tacgggcgcg acctgctctc gagggtgctc       240
     tatggcgcgc gcttttccct ctcggtggcg gcggtctcgg tgctggcggg gttgctggtg       300
     ggcggcaccc tgggcctgct ggccggctac ttcaggggct ggctcgatct ggtcatctcc       360
     cgcctggccg acatcctgat cgcctatccg gccatcctgc tggccatcgc ttttctggct       420
     tttttagggg gcggcttcat caacctggtg ctggccatct cggtggtgtt tgtggggccc       480
     tttatccggg tagcccgggc cgccgttcta accgtgcgcg aggaacttta cgtggaggcc       540
     gggcgggcca tgggcgcttc ggatgcccgc atgatctttc gtaccatcct gcccaacgcc       600
     gccgccccgc tcatcgtgga ggtcacgctg cgctttgcct atgcggtgct ggccgaggcg       660
     gctctgtcgt tcctgggcct gggcatccag ccccccttcc cggccctggg ctccatggtc       720
     tcggaggggc gggccttcct ctcgctttcg ccctggggct cgctggtgcc ggggtgcgcc       780
     atcgtgctga tggtgctggg cttcaacctg ctgggcgatg gcctgcgcga cgccctcgac       840
     ccccggctgc aaaaggctta g                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page