(data stored in ACNUC7421 zone)

EMBL: CP001743.PE167

CP001743.PE167       Location/Qualifiers
FT   CDS_pept        complement(148959..150152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0169"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; SPTR: P16557 Xylose
FT                   repressor; InterPro IPR000600; COGs: COG1940
FT                   Transcriptional regulator/sugar kinase; KEGG: bha:BH2758
FT                   transcriptional repressor of the xylose operon; PFAM: MarR
FT                   family; ROK family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26949"
FT                   /protein_id="ADD26949.1"
FT                   /translation="MARTTPLDQQAIKRLNRRLILEALRRHGPQSRAALARAVGLTKST
FT                   VSTLVQEMLEEGLLDEGSRHKPGLGRPGTALEFSPRHTLALGVELGVENTQLVLLDLNN
FT                   TIHDKWDWVESPHTPLAERLTKLAEQVQSRLSDPTRLLGIGLAVPGVVNGRRLLYAPGP
FT                   GWHNEQPAEMLEALLKVPTLVDNDANAAALGETFWGEQQSPLVYVLMTTGLGTGLVVDG
FT                   QVYRGRLGAAGELGHWLTGQPHSRSRAGDVEGTLSLRAMVERYQAASNRKEGFWGILQR
FT                   AEHQDPYALQALQNLAYELGRFVVNLCVAFDPAVVVLGGAGAEAWKWLEAPLRQTIHNL
FT                   AFIPEHAEIPVKPSAFGHLAPAMGAAALVLQRFLANGGTGEWSPPISPLGTRSTIGV"
     atggcccgca ccacccccct tgaccagcaa gccatcaagc ggctcaaccg ccgcctgatc        60
     ctggaggccc tgcgccgcca tggcccacaa agccgggccg cgctggcccg ggcggtgggt       120
     cttaccaaga gcacggtctc cacgctggtg caggagatgc tggaggaggg cttgctggac       180
     gaaggcagcc gccacaagcc gggcctgggc cgcccaggca ccgcgctcga gttctctccc       240
     cggcacaccc tggccctggg ggtcgagctg ggcgtggaaa acacgcagct tgtgctgctc       300
     gacctgaaca acaccatcca cgacaaatgg gactgggttg aaagccccca caccccgctg       360
     gccgagcggc taaccaagct ggccgaacag gtgcaaagcc ggctttccga ccccacccgg       420
     ctgctgggga tcgggctggc cgtcccaggg gtggttaacg gtcgcagact gctttatgca       480
     ccaggccccg gctggcacaa cgagcagccc gcagagatgc tcgaggccct gctcaaagta       540
     cccaccctgg tagacaacga tgccaacgcc gccgccctgg gcgaaacctt ctggggcgag       600
     cagcaaagcc ccctggtcta cgtgctcatg accaccggcc tgggcaccgg cctggtggtg       660
     gacggccagg tctaccgggg ccggctgggg gccgccggtg agctgggcca ctggctcacc       720
     ggccagcccc acagccgcag ccgggctggg gacgtggagg gaaccctatc gctgcgggcc       780
     atggtggagc gctaccaggc cgccagcaac cgcaaagaag gcttctgggg tatcctgcag       840
     cgggccgagc accaagaccc ctacgccctg caggccctgc aaaacctggc ctacgaactg       900
     gggcgctttg tggtcaacct gtgcgtcgcc ttcgacccag cggtggtggt gctgggcggg       960
     gccggggccg aggcctggaa gtggctcgag gcccccctgc gccagaccat tcacaacctg      1020
     gcttttatcc ccgaacacgc cgaaataccc gtaaagccca gcgcgttcgg acatctggct      1080
     ccggctatgg gcgctgcggc cctggtgctg cagcgctttt tagcaaatgg tggaaccggg      1140
     gagtggagcc cgccaatctc ccccctggga acccggtcaa ccattggcgt atag            1194
//

If you have problems or comments...

PBIL Back to PBIL home page