(data stored in ACNUC7421 zone)

EMBL: CP001743.PE169

CP001743.PE169       Location/Qualifiers
FT   CDS_pept        complement(150772..151602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0171"
FT                   /product="degV family protein"
FT                   /note="TIGRFAM: degV family protein; PFAM: DegV family
FT                   protein; InterPro IPR003797; KEGG: bcy:Bcer98_1648 DegV
FT                   family protein; COGs: COG1307 conserved hypothetical
FT                   protein; SPTR: A8CTV0 DegV family protein; PFAM:
FT                   Uncharacterised protein, DegV family COG1307; TIGRFAM: EDD
FT                   domain protein, DegV family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26951"
FT                   /protein_id="ADD26951.1"
FT                   /translation="MERTAFVADSTLGLSPQEALERGIYLVPQQVILEGQSYRDYLEMT
FT                   PDQVIQAQLAGKKVSTSQVSAADLEALYKALLEKFDRIVSVHVSSKLSGTYSTARKVAE
FT                   QFGNRVKVIDGLTLNGGLSFVIEEVRRKLAAGVPWDRLEEAIAPLVQRIRGFVLPATLE
FT                   YLHRGGRIGGLQHFIGSLLKLLPVLEVRDGLVRPLERARGWHRGLQQLAEAFHKAFPEG
FT                   ARVVLAHAYNPQGAEELRRLISQEGVIVEDVRACGPAVAAHTGPGTVALFAAPR"
     atggaacgca ccgccttcgt ggccgactcg accctgggcc tttcaccgca agaagccctc        60
     gagcgaggca tctacctggt tccccagcag gtcatcctcg agggccagag ctaccgcgac       120
     tacctcgaga tgacccccga ccaggtaatc caggcccagc tcgcgggcaa gaaggtaagc       180
     accagccagg tttcggcagc cgatctggaa gctttgtata aagctttgct cgagaaattc       240
     gaccgcatcg tctcggtgca cgtctccagc aagctctcgg gcacctattc gaccgcccgc       300
     aaggtggccg aacaatttgg caaccgcgtc aaggtgattg acggcctgac cctgaacggc       360
     gggctttctt ttgtgatcga ggaagtgcgg cgcaagctgg ccgcgggggt gccctgggat       420
     cggctggaag aggccatcgc gccgctggtg cagcgcatac gcggcttcgt gctgccggcc       480
     acgctggagt acctgcaccg gggcgggcgc atcggcggac tgcagcattt catcggctcg       540
     cttttgaagc tgctgccggt gctggaggtt cgggacgggc tggtgcggcc ccttgagcgg       600
     gcccggggct ggcacagggg tttgcagcag cttgccgagg ccttccacaa agccttcccc       660
     gaaggagccc gggtggtgct ggcccacgcc tacaaccccc agggggccga ggagttgcgc       720
     aggctaatca gccaggaagg cgtgatcgtc gaggacgtgc gcgcgtgcgg cccggcggtg       780
     gcggctcata ccggccccgg cacggtggcg ttgtttgcag ccccccgcta a                831
//

If you have problems or comments...

PBIL Back to PBIL home page