(data stored in ACNUC7421 zone)

EMBL: CP001743.PE17

CP001743.PE17        Location/Qualifiers
FT   CDS_pept        15590..17449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0017"
FT                   /product="deoxyxylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /note="SPTR: Q72H81 1-deoxy-D-xylulose-5-phosphate
FT                   synthase; KEGG: mpt:Mpe_A2631
FT                   1-deoxy-D-xylulose-5-phosphate synthase; COGs: COG1154
FT                   Deoxyxylulose-5-phosphate synthase; InterPro
FT                   IPR005476:IPR005475:IPR005477; TIGRFAM:
FT                   deoxyxylulose-5-phosphate synthase; PFAM: Transketolase
FT                   central region; Transketolase domain protein; PFAM:
FT                   Transketolase, C-terminal domain; Transketolase, pyrimidine
FT                   binding domain; TIGRFAM: 1-deoxy-D-xylulose-5-phosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26799"
FT                   /protein_id="ADD26799.1"
FT                   /translation="MILQKVNQPQDLKTLTQEELLQLAQELRSEIIRVCAQNGGHLASS
FT                   LGAVELIVALHRVFDSPRDRLLFDVGHQAYAHKILTGRKEVFHTIRQEGGISGFTKVSE
FT                   SEHDAITVGHASTSLANALGMAIARDTLGENYHVVGIIGDGALTGGMALAALNVIGERK
FT                   PRLLMILNDNEMSISENVGALNRYFKEYQTKKWVQDTQKWGKQVLEGISPRLFSLVDRA
FT                   KEAAKLMLHQENPFYAWGIRYVGPVDGHDLPGLIHILEQIKELDGPTLLHIVTQKGKGY
FT                   GVAEEDPIYWHGPPGFNPQKPEKVSKGYSWSAAFGDAVTELAHKEPRLFVITPAMREGS
FT                   GLVKYSQTHPERYLDTGICEDVAATVAAGMALRGLKPVLAIYSTFMQRAYDQIIHDIAI
FT                   ENLSVVFAVDRAGIVGGDGATHNGVFDIAYLRTVPNVQIAAPKDALELRAMLKKALELG
FT                   GPIAIRYARDNVEKAPEGVWPEIEWGRWEVLKEGSKAYILAFGKTLKYALEAAQDHPEI
FT                   GVINARFLKPLDKGMLEALALEGYKLVTTEDHQKMGGFGSAVLEALNELGLKPDIRVLG
FT                   LPDVFFDHGSIPRMHREAGIDAAAIRAALAGMGLEVKTATRRV"
     gtgatattgc aaaaggtcaa ccagccgcaa gacctcaaaa ccctcacgca agaagagctg        60
     ctgcaactgg cccaggaact gcgcagtgag attatccggg tgtgcgccca gaacggcggc       120
     cacctggctt cctcgctggg ggcggtggag ctgattgtgg ccctgcaccg ggtgtttgac       180
     tcgcccaggg atcgcctgtt gttcgatgtg ggtcaccagg cttatgccca caaaatcctg       240
     accgggcgca aggaggtctt ccacaccatc cgccaggaag ggggcatctc gggctttacc       300
     aaggtctcgg agagcgagca cgacgccatt acggtgggcc acgcctccac ctcgctggcc       360
     aacgccctgg gcatggctat tgcccgcgat accctgggcg aaaactacca tgtggtgggc       420
     atcatcggcg acggggccct gaccggcggg atggccctgg ccgcgctcaa cgtgattggc       480
     gagcgcaagc ccaggctgct gatgattctg aacgacaacg agatgtccat ctccgagaac       540
     gtgggggccc tgaaccgcta cttcaaggag tatcagacca agaaatgggt acaggacacc       600
     cagaagtggg gtaagcaggt cttggagggc atctcacccc ggctctttag cctggtagac       660
     cgggccaagg aggccgccaa gctgatgctg caccaggaga acccctttta cgcctggggc       720
     atccgctatg tggggccggt ggacgggcac gacctgccgg gcctgattca catcctcgag       780
     cagatcaaag aactcgacgg ccccaccctg ctgcacatcg tgacccagaa aggcaagggc       840
     tacggggtgg ccgaggaaga ccccatctac tggcacgggc cgcccggctt caacccccaa       900
     aaacccgaga aggtgagcaa gggttactcc tggtcggcgg cctttggcga cgcggtgacc       960
     gagctggccc ataaggagcc ccggcttttc gtcatcaccc cggccatgcg cgagggttcg      1020
     gggctggtga agtactccca gacccacccc gagcgctacc tggacaccgg catctgcgag      1080
     gatgtggcgg ccacggtggc ggcgggcatg gccctgcggg gcctcaagcc ggtgctggct      1140
     atttactcga ccttcatgca gcgggcctac gaccagatca tccacgacat cgccatcgag      1200
     aacctgtcgg tggtgtttgc ggtggatcga gccgggattg tggggggcga cggggctacc      1260
     cacaacggcg ttttcgacat cgcctacctg cgcaccgtgc ccaacgtgca gattgccgcc      1320
     cccaaggatg ctctggagct tcgggccatg ctcaagaagg ccctggagct gggcgggccc      1380
     atcgccatcc gctacgcccg cgacaacgtg gaaaaagccc ccgagggggt ctggcccgag      1440
     atcgagtggg gccgctggga ggtgctgaag gagggctcca aggcttatat cctggccttt      1500
     ggcaagaccc taaagtatgc cctcgaggcc gcccaggatc accccgagat tggcgtcatc      1560
     aacgcccgct tcctcaagcc gctggacaag gggatgctgg aagcgctggc cctggagggc      1620
     tacaagctgg tgaccaccga agaccaccag aagatggggg ggtttggcag cgcggtgctg      1680
     gaagccctta atgaactggg cctgaaaccc gatatccgcg tgctgggcct gccggatgtc      1740
     ttctttgacc atggctccat tccccgcatg caccgcgagg ccggcattga cgctgcggcc      1800
     atccgggcag ccctggccgg gatgggcctc gaggtcaaga cggccacccg ccgggtgtga      1860
//

If you have problems or comments...

PBIL Back to PBIL home page