(data stored in ACNUC7421 zone)

EMBL: CP001743.PE170

CP001743.PE170       Location/Qualifiers
FT   CDS_pept        complement(151683..152522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0172"
FT                   /product="degV family protein"
FT                   /note="TIGRFAM: degV family protein; PFAM: DegV family
FT                   protein; InterPro IPR003797:IPR001555; KEGG:
FT                   bcy:Bcer98_1648 DegV family protein; COGs: COG1307
FT                   conserved hypothetical protein; SPTR: Q9RSY3 UPF0230
FT                   protein DR_1986; PFAM: Uncharacterised protein, DegV family
FT                   COG1307; TIGRFAM: EDD domain protein, DegV family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26952"
FT                   /protein_id="ADD26952.1"
FT                   /translation="MKIAIVTDSTSDLQSRAAEMGVEIVPLYVNFKGKIHKDWVEITPS
FT                   DIFEGVKAGAGMPSTSQPSPTDFKLAYERALQKADHVLSIHISSKLSGTVQSAQLASQE
FT                   FPGKVTIFDTQAASMGIGMMVERAKELLDQGADLGQVLVELERIRADHTVRFTLATLDY
FT                   LKKNGRIGGAQALLGSLLGIKPILTLKDGRVEAAGRARGEKKALAEMVEALKSWAAGRQ
FT                   KIRIYYLYNAEESDLAAFKAAVQAAGLPLEERLTTSIGGVISTHTGPGVYGFYAYSL"
     atgaaaatag ccatcgtaac cgactcgacc tccgacctac agagccgcgc cgccgagatg        60
     ggcgtcgaaa tagtgcctct atacgtcaac ttcaagggca aaatccacaa ggactgggtt       120
     gagattaccc ccagcgatat cttcgaaggg gttaaggccg gggccggaat gcccagcacc       180
     agccagccct cccccaccga cttcaagctg gcctacgagc gggccttgca gaaagccgat       240
     cacgtgctct cgattcacat ctcctccaaa ctttccggca ccgtgcagtc ggcccagctc       300
     gccagccagg agtttccggg caaggtgacc atcttcgata cccaggccgc cagcatgggc       360
     attgggatga tggtcgagcg ggccaaggag ctgctcgacc agggggccga cctggggcag       420
     gtcttggtgg agctcgagcg catccgcgcc gaccacacgg tgcgctttac cctggctacc       480
     ctggactacc tcaagaaaaa cgggcgcatc ggcggggccc aggccctgct gggcagccta       540
     ttgggcatca agccgatcct gactctgaaa gatgggcggg tagaggccgc aggccgggcc       600
     cggggtgaga agaaagccct ggccgagatg gtcgaagccc tcaaaagctg ggctgcaggc       660
     cgccagaaaa tccgcatcta ctacctctac aacgccgaag aaagcgacct ggccgccttc       720
     aaggccgccg tgcaggccgc cgggctgccc ctggaggaac gcctcactac cagcatcggc       780
     ggggtgatct cgacccatac cgggccgggg gtgtacgggt tctatgccta cagcctctag       840
//

If you have problems or comments...

PBIL Back to PBIL home page