(data stored in ACNUC7421 zone)

EMBL: CP001743.PE171

CP001743.PE171       Location/Qualifiers
FT   CDS_pept        152782..154347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0173"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /note="TIGRFAM: D-3-phosphoglycerate dehydrogenase; PFAM:
FT                   D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding;
FT                   D-isomer specific 2-hydroxyacid dehydrogenase catalytic
FT                   region; amino acid-binding ACT domain protein; InterPro
FT                   IPR006139:IPR002912:IPR006140:IPR006236; KEGG:
FT                   glo:Glov_2087 D-3-phosphoglycerate dehydrogenase; COGs:
FT                   COG0111 Phosphoglycerate dehydrogenase and related
FT                   dehydrogenase; SPTR: O29445 D-3-phosphoglycerate
FT                   dehydrogenase; PFAM: ACT domain; D-isomer specific
FT                   2-hydroxyacid dehydrogenase, NAD binding domain; TIGRFAM:
FT                   D-3-phosphoglycerate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26953"
FT                   /protein_id="ADD26953.1"
FT                   /translation="MWKVLVTDEMRLGEVKHPQVRLDYKPGMAREELLQVIGAYDALIT
FT                   RSRTQVDARVLEAGVNLKVVGRGGVGVDNVDLEAASRRGILVVNVPEANTRSAAELAWA
FT                   LLLATARGLVESDQKIRQGQWDRKYLGLELNHKTLGIVGLGRIGGQVAKFAKGFDMRVL
FT                   AYDPYIPRSRAQTLGVELFDDLADMLRQCHFLTVHTPLTEETRGLIGRRELYLLPKGAV
FT                   VVNAARGGIVDEKALVEVLNDGHLWGAGLDVFVEEPPNAEHPLVHHPKVVHTAHLGANT
FT                   IEAQERVGEAVLERVIETLQGNLAHALNTGFDAEGLQLFSAWLPLGEALGKLLAQITQG
FT                   RPQAVEVSYYGDFEKNPDPIASAVAKGLLEQVLEAGAINLVSARPLLRDRGIALVTRQV
FT                   QEPLDYRQVLEVRLETDKETRKVRGAVLGGKPRIVGIDDHTVEAVPRGFMLVCINRDRP
FT                   GVVGKVGTLLGENNINIAGMQLGRDNPGGKALFVLAIDERPGEAVLSALRGLDVLERVD
FT                   LAEL"
     atgtggaaag tgctagtgac cgacgagatg cggctggggg aggttaagca cccccaggta        60
     cgcctggact acaagcccgg catggcgcgg gaggagctgc ttcaggtgat tggcgcctac       120
     gatgccctga ttacccgcag ccgcacccag gtggacgcca gggtgctgga ggccggggtc       180
     aacctgaagg tggtgggccg gggtggggtg ggggtggaca atgtagacct ggaagccgcc       240
     tcccgccggg gcatcctggt ggtgaatgtg cccgaggcca acacccgctc cgccgccgag       300
     ctggcctggg ctctgttgct ggctacggcg cggggcctgg tggagtccga tcagaaaatc       360
     cggcagggcc agtgggatcg caagtacctg ggcctcgagc tcaaccacaa gaccctgggc       420
     atcgtgggcc tggggcgcat tggggggcag gtggccaagt tcgccaaggg cttcgatatg       480
     cgggtgctgg cctacgaccc ctacatcccg cgcagccgcg cccagaccct gggggtcgag       540
     cttttcgacg acctggccga tatgctgcgc cagtgccact tcctgaccgt gcacaccccc       600
     ctcaccgagg agacccgcgg cctgattggc cgccgcgagc tctacctgct gcccaaaggg       660
     gcggtggtgg tgaatgccgc gcggggcggc attgtggatg aaaaggccct ggtggaggtt       720
     ttgaacgacg gacacctgtg gggggccggg ctggacgtgt ttgtggagga gccccccaac       780
     gccgaacacc ccctggtaca ccaccccaag gtggtgcaca ccgcccacct gggggccaac       840
     accatagagg cccaggagcg ggtgggggag gcggtgctcg agcgggtcat cgagaccctg       900
     cagggcaacc tggcccatgc cctcaacacc ggcttcgacg ccgagggcct gcaactcttc       960
     tcggcctggt tgccgctggg tgaggctctg ggcaagctgc tggcccagat cacccagggc      1020
     cgtccccagg cggtggaggt ctcgtactac ggcgatttcg agaaaaaccc cgatcccatc      1080
     gcctcggcgg tggccaaggg cctgctggag caggtgctgg aggctggggc tatcaacctg      1140
     gtctcggccc ggccgctgct gcgcgaccgg ggcattgcgc tggtgacccg gcaggtgcag      1200
     gagccgctcg attaccgcca ggtgctggag gtgcgcctcg agaccgacaa agagacccgc      1260
     aaggtgcggg gcgcggtgct gggcggcaag ccccgcatcg tgggcattga cgaccacacg      1320
     gtggaggcgg tgcccagggg ctttatgctg gtctgcatca accgcgaccg gcctggggtg      1380
     gtgggcaagg tgggcaccct gctgggcgag aacaacatca acatcgcggg tatgcagctc      1440
     ggtcgcgaca accccggcgg caaagccctg tttgtgctgg ctattgacga acggcccggc      1500
     gaggcggtgc tctcggccct gcgcgggctg gatgtgctgg agcgggtgga tttggccgag      1560
     ctgtag                                                                 1566
//

If you have problems or comments...

PBIL Back to PBIL home page