(data stored in ACNUC7421 zone)

EMBL: CP001743.PE179

CP001743.PE179       Location/Qualifiers
FT   CDS_pept        complement(160572..161015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0181"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce0333 hypothetical protein; SPTR: A1ZGI2
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26961"
FT                   /protein_id="ADD26961.1"
FT                   /translation="MYEFLLSFHNIARWLVLLAAVYLIYRSIMGLKNHTYTAADRRAGQ
FT                   VYTGLMDLQLLLGILLMLLSPFVQSALNNPGAAMQNSQTRFFIAEHWVLMLAAVILAHL
FT                   GNVRVKKAADALLKHRQALIWYGLSVALVLLAVPWWRPLLRLG"
     atgtacgagt ttctactctc tttccacaac atcgcccgct ggctggtgct gctcgccgct        60
     gtgtacctga tctatcggag catcatgggg ctcaaaaacc acacctatac tgccgccgat       120
     cgccgcgccg gccaggtgta taccggtctg atggatcttc aactgcttct gggtattctg       180
     ttgatgctgc tgagtccctt tgttcaaagc gcgctgaaca accctggcgc ggccatgcaa       240
     aacagccaaa cccgcttttt tatcgccgaa cactgggtgc tgatgctcgc cgccgtgata       300
     ctggcgcatc tgggcaacgt ccgcgtcaaa aaagccgccg acgccctgct caagcaccgc       360
     caagccctga tctggtacgg gctgagcgta gccctggtgt tgctggccgt cccctggtgg       420
     cggcctctac tgcgcctcgg gtga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page