(data stored in ACNUC7421 zone)

EMBL: CP001743.PE182

CP001743.PE182       Location/Qualifiers
FT   CDS_pept        162886..163053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26964"
FT                   /protein_id="ADD26964.1"
FT                   /translation="MDEALLTNDMAMLEARLAMFAQARRELVAARAALFTETARWVRAM
FT                   FRPWKGVRYG"
     gtggatgagg cgctgctgac caacgacatg gcaatgctcg aggcccgcct ggctatgttt        60
     gcccaggccc ggcgtgagct ggtggcggct cgggctgcat tgtttaccga aacagcccgt       120
     tgggtgcggg ccatgttccg cccctggaag ggagtgcggt atggatag                    168
//

If you have problems or comments...

PBIL Back to PBIL home page