(data stored in ACNUC7421 zone)

EMBL: CP001743.PE188

CP001743.PE188       Location/Qualifiers
FT   CDS_pept        165539..165739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26970"
FT                   /protein_id="ADD26970.1"
FT                   /translation="MSRAMARTTSKTPRKVKVPRRLTQGPEQLGPLADWVDRHSTRLEL
FT                   GPIDPELDRQITHRLTKPRYE"
     atgagtagag ccatggctag aaccacctcc aaaacccccc gcaaagttaa ggtgccccgc        60
     cgtctgaccc aagggcccga acaactgggc ccccttgccg actgggtcga tcggcacagc       120
     acccggctgg agctgggccc gattgacccg gagcttgacc ggcagatcac ccaccgccta       180
     accaagccgc gctatgaatg a                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page