(data stored in ACNUC7421 zone)

EMBL: CP001743.PE189

CP001743.PE189       Location/Qualifiers
FT   CDS_pept        165732..166106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26971"
FT                   /protein_id="ADD26971.1"
FT                   /translation="MNDAPPFTTRRRATYERSLAYRLGLRACAKRNSLSPAEIEHRHIL
FT                   EVITGSAEAAEYLAHEFPTLYALAQFGSRYGFKRLEFCPGISYAAIGKLEVWLESQGRV
FT                   GMQLTVAHGSDWPKRKHRRG"
     atgaatgatg cacccccttt tacaacccgt cgcagggcta cctatgaacg ctcgctagcc        60
     taccgtttgg gcctgcgggc ctgtgccaag cggaatagcc tatcgcctgc tgagatcgag       120
     caccgccaca tcctcgaggt cattaccggc tccgccgagg ctgccgagta cctggcccac       180
     gagttcccca ccctgtacgc cctggcccag tttggtagcc gttacgggtt caagcggctg       240
     gagttctgcc cagggatcag ttacgcggcc attggcaagc tggaggtgtg gctcgagtcc       300
     cagggccgcg tagggatgca gctcacggtg gcgcatggtt cggattggcc aaaacgaaaa       360
     catcggaggg ggtga                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page