(data stored in ACNUC7421 zone)

EMBL: CP001743.PE19

CP001743.PE19        Location/Qualifiers
FT   CDS_pept        17868..18491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0019"
FT                   /product="beta-lactamase domain protein"
FT                   /note="COGs: COG0491 Zn-dependent hydrolase including
FT                   glyoxylase; InterPro IPR001279; KEGG: met:M446_1047
FT                   beta-lactamase domain-containing protein; SPTR: A2UAT4
FT                   Beta-lactamase-like; PFAM: beta-lactamase domain protein;
FT                   PFAM: Metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26801"
FT                   /protein_id="ADD26801.1"
FT                   /translation="MKVFALAANTYLLDTPQGPLLVDSGLPGQRRRLERYLGSVKPAAL
FT                   LLTHHHLDHVGGAQMLWERYGLPIYAHPLDIPFISGEARRPPFPPIPGLGDWIANSPRP
FT                   VPKEALRPVEEGAEVMGWQVVHLPGHTPGQIGLLREGVLLAADALRVGVKGPWVPPAMV
FT                   NHDTQQARRTVGKIARLEAQKIYVGHGPPTTALAVRALAEKLGV"
     atgaaagtct ttgcgctggc ggccaacacc tacctgctgg acacaccgca aggcccgctg        60
     ctggtggact cggggctgcc gggccagcgg cgcaggctcg agcgctatct gggtagtgtg       120
     aagcctgctg ccctgctgct cacccaccac cacctcgacc acgtgggcgg ggcccagatg       180
     ctctgggagc gctacgggct gcccatctat gcccatccgc tggatatccc cttcataagc       240
     ggggaagcgc gccgcccacc ttttccgccc attcccgggc tgggtgactg gattgccaac       300
     agcccccggc cggtacccaa agaggccctg aggcccgttg aagaaggcgc ggaagtgatg       360
     ggctggcagg tggtgcacct gcccggccat acccccggtc agattggcct gctgcgtgaa       420
     ggggttttgc tggctgccga cgcgctgcgg gtgggtgtga aaggcccctg ggttcccccg       480
     gccatggtca accacgacac ccaacaggcc cggcgcacgg tggggaagat cgcccgcctc       540
     gaggcccaga agatctacgt ggggcacggg ccgcccacca ctgccctggc ggtgcgcgcc       600
     ctggccgaaa agctgggggt ctga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page