(data stored in ACNUC7421 zone)

EMBL: CP001743.PE192

CP001743.PE192       Location/Qualifiers
FT   CDS_pept        168324..168962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0194"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="TIGRFAM: ATP phosphoribosyltransferase; PRIAM: ATP
FT                   phosphoribosyltransferase; PFAM: ATP
FT                   phosphoribosyltransferase catalytic region; InterPro
FT                   IPR013820; KEGG: pca:Pcar_2689 ATP
FT                   phosphoribosyltransferase catalytic subunit; COGs: COG0040
FT                   ATP phosphoribosyltransferase; SPTR: Q5SM15 ATP
FT                   phosphoribosyltransferase; PFAM: ATP
FT                   phosphoribosyltransferase; TIGRFAM: ATP
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26974"
FT                   /protein_id="ADD26974.1"
FT                   /translation="MIRGRFTLVVALPKGRNFADGYRALAQAGLELPPLEGERALLHGQ
FT                   EGGVAVLELRNHDVPTYVDLGIADVGVVGNDVLLESGRDVYEPVDLGTGACRLSLIRHP
FT                   AATDPIRRIATKYPRFTAQVLRERGMVADIIELAGNVELAALTGLADAVVDVVQTGATL
FT                   KAAGLLEVEVLAHSTARFIVNRQSLKLKRDLLRPLIERLRANAHNLPAS"
     atgattcgag gacgtttcac gctggtggtg gctttgccca aggggcgcaa cttcgcagat        60
     ggctacaggg ccctggcgca ggccgggctg gaactgcccc ccctcgaggg cgaacgggcc       120
     ttgctgcatg ggcaggaggg gggggtggcg gtgctcgagc tgcgcaacca cgacgtgccc       180
     acctacgtcg acctgggcat tgccgatgtg ggggtggtgg gcaacgacgt gctgctggag       240
     tcggggcgcg atgtgtacga gccggtggat ctgggcacgg gggcctgccg cctttcgctc       300
     atccgccacc cggctgcgac cgaccccatt cgccgaattg ccaccaaata cccccgcttt       360
     accgcgcagg tgctgcgcga acgggggatg gtggccgata tcatcgagct ggccggtaat       420
     gttgagctgg ccgccctcac cgggctggcc gatgcggtgg tggacgtggt gcagaccggg       480
     gctaccctca aagcggcggg cttgctcgag gtcgaggtgc tggcccactc caccgcccgc       540
     tttatcgtga accgccagtc gcttaagctc aagcgcgacc tgttgcgtcc ccttatcgag       600
     cgcctgcggg ccaacgccca caacctgccc gcttcctaa                              639
//

If you have problems or comments...

PBIL Back to PBIL home page