(data stored in ACNUC7421 zone)

EMBL: CP001743.PE194

CP001743.PE194       Location/Qualifiers
FT   CDS_pept        complement(170049..171017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0196"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; SPTR:
FT                   A6CQ11 Quinone oxidoreductase; InterPro
FT                   IPR013154:IPR013149:IPR002364; COGs: COG0604 NADPH:quinone
FT                   reductase and related Zn-dependent oxidoreductase; KEGG:
FT                   bcz:BCZK1920 quinone oxidoreductase; PFAM: Zinc-binding
FT                   dehydrogenase; Alcohol dehydrogenase GroES-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26976"
FT                   /protein_id="ADD26976.1"
FT                   /translation="MKAIVVEQNGPPEHLRYREVPEPSPGPDEVLVRTSLTSLNYADVQ
FT                   ARRGGYEAGSPPPFIPGLDAVGVVEALGAEVRGLALGQRVAVFASGGSYAEKVLAKGVL
FT                   TYPVPDDLPDEAVAGLTALVTAYNTLTWAGRLQPNETVLVHAAAGGVGSLAVQMAKALG
FT                   AGLVIGTVGHPAKAGFVRSLGADAVVGYEGFAEQVLERTQQKGADLILDSVAGEVFSQG
FT                   MRCLAPFGRLVVYGHASGQAGSFETRPLHRQTKAVIGYSSGHYRRNRPELLRPTVEAVF
FT                   ALLRSGRIRLHIGARYSLEQAAQAHALMESRQSTGKILLYP"
     atgaaagcca tcgtggttga acagaacggc ccgcccgaac acctgcgcta ccgggaggtg        60
     cccgaaccca gccccgggcc cgacgaggtg ctggtgcgca ccagcctgac cagcctcaac       120
     tacgccgacg tccaggcccg gcggggcggc tacgaggccg gttcaccgcc cccttttata       180
     ccggggctgg atgcggtagg ggtggtggaa gccctgggcg cggaggtcag gggcctggcg       240
     ctggggcaac gggtggcagt ctttgcgagt gggggctcgt acgccgaaaa agtactggct       300
     aaaggggtgc taacctaccc agttcccgac gacctgcccg acgaagcggt cgcgggcctg       360
     accgccctgg tcacggccta caacaccctg acctgggctg ggcgcttgca gccaaacgag       420
     accgtgctgg tgcacgccgc tgcgggtggc gtgggcagcc tggcggtgca gatggcgaag       480
     gccctgggcg cggggctggt catcggaacc gtggggcatc cggccaaggc cgggttcgtc       540
     cgcagtctgg gggccgatgc cgtggtgggg tacgagggct ttgctgaaca ggtgctcgag       600
     cgaacccagc aaaaaggcgc tgatctgatc ctcgactcgg tggcggggga ggtttttagc       660
     cagggcatgc gctgcctagc cccttttggc cgcctggtgg tgtacgggca tgccagcggc       720
     caggccggca gcttcgagac ccgcccgctg caccgccaga ccaaagccgt catcggctac       780
     agcagcgggc attaccggcg caatcggccc gagctgctgc ggcccaccgt ggaggccgtc       840
     tttgccctgc tccggtcagg taggatccgg cttcacattg gagcgcgcta cagcctcgag       900
     caggccgccc aagcccacgc cctaatggaa agccggcaga gcaccggcaa aatcctgctc       960
     tatccctaa                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page