(data stored in ACNUC7421 zone)

EMBL: CP001743.PE198

CP001743.PE198       Location/Qualifiers
FT   CDS_pept        complement(173788..174729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0200"
FT                   /product="ribokinase"
FT                   /note="COGs: COG0524 Sugar kinase ribokinase family;
FT                   InterPro IPR002139:IPR011611:IPR011877; KEGG:
FT                   bur:Bcep18194_C7623 ribokinase; PFAM: PfkB domain protein;
FT                   SPTR: A7CMJ7 Ribokinase; TIGRFAM: ribokinase; PFAM: pfkB
FT                   family carbohydrate kinase; TIGRFAM: ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26980"
FT                   /protein_id="ADD26980.1"
FT                   /translation="MSIVVVGSINMDLVVRVKRHPVPGETLLGSDYETHHGGKGANQAV
FT                   AAARMLARPMPTKSASPGPAPGVRMIGRVGQDEFGQQLRNALKREGINVSATLPIAAPT
FT                   GVAFIAIDEEGQNTIIVSPGANHRLRPEHLSPAEFEEARVVVLQLEIPLETVRRAAELG
FT                   RQAGAQVILNAAPAQKLPDKLLHHIDILVVNEIEALGLSGVKPDSPEMALEVAQLLAKK
FT                   VPTVIITLGEQGAVWASPEGQGHQPVPEVEVVDATGAGDAFIGALAAALCEGRPLAQAV
FT                   AHGCVAGALATTKTGAQSSLPWREEVCARLEL"
     atgagcattg tggtggtggg aagcatcaac atggatctgg tggtgcgggt caagcgacat        60
     ccggttcccg gcgaaaccct cctgggctcg gattacgaga cccatcacgg cggtaaaggg       120
     gccaaccagg ccgtggccgc cgcgcgcatg ctggcccgcc ccatgcccac caaaagcgcc       180
     agccccggcc cagcccccgg ggtgcgcatg attggtaggg tggggcagga tgagttcggc       240
     cagcaactgc gcaacgccct caagcgcgag gggatcaatg tgagcgccac ccttcccatc       300
     gcggccccca ccggcgtggc tttcattgcg attgatgagg aagggcagaa caccatcatc       360
     gtctcgccgg gggccaacca ccgcctacgg cccgagcacc tctcccccgc cgagttcgag       420
     gaggcccggg tggtggtctt gcagctcgag attcccctcg agaccgtgcg acgggcggcc       480
     gagctgggcc gccaggccgg cgctcaggtc atcctgaacg ctgcacctgc gcaaaaactg       540
     cccgataaac tcctacacca tatcgacatc ctagtggtca acgaaatcga agccctgggc       600
     ctgagcgggg tcaagcccga ctcacccgag atggccctcg aggtagccca gctactggct       660
     aaaaaagtgc ccaccgtcat catcaccctg ggtgaacagg gagcagtgtg ggcatccccc       720
     gagggccagg gacatcagcc agttcccgaa gtagaggtcg tcgatgccac tggggccggg       780
     gatgccttta tcggggcatt ggccgcagcc ctctgtgagg gaaggcccct ggcccaggcg       840
     gtggcccacg gctgtgtggc cggggccctg gctaccacca aaaccggcgc tcaatcctcg       900
     ctgccctggc gcgaggaggt gtgcgcgcgg ctcgagcttt ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page