(data stored in ACNUC7421 zone)

EMBL: CP001743.PE2

CP001743.PE2         Location/Qualifiers
FT   CDS_pept        1862..2947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="COGs: COG0592 DNA polymerase sliding clamp subunit
FT                   (PCNA homolog); KEGG: rpt:Rpal_0002 DNA polymerase III,
FT                   beta subunit; SPTR: A3WSP5 DNA polymerase III subunit beta;
FT                   SMART: DNA polymerase III beta chain; PFAM: DNA polymerase
FT                   III beta chain; PRIAM: DNA-directed DNA polymerase;
FT                   TIGRFAM: DNA polymerase III, beta subunit; InterPro
FT                   IPR001001; PFAM: DNA polymerase III beta subunit,
FT                   C-terminal domain; DNA polymerase III beta subunit,
FT                   N-terminal domain; DNA polymerase III beta subunit, central
FT                   domain; TIGRFAM: DNA polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26784"
FT                   /protein_id="ADD26784.1"
FT                   /translation="MEVRIPKRTLAEGLSILERIIPSRSSNPILTYLPMELSDQGLILR
FT                   GTNGEVDIEVKLPAEVQGTGQVLVPAQTFVQIVRSAPGELVELIFGGKERLELHSGAFN
FT                   TQLATTGPDGYPELSFGPPGPEKIAASRLAQAITRVRYAASTEEFRAIFRGVQIEMSPT
FT                   SLRAVASDGYRLACYDLPMQLQTRKLVIPARSADEIVRVFKDAQGEVALAVAEGTLTLV
FT                   GEAVRMSVKLMEGEFPDYGRVIPQSFVLEATLQAEALRESLKRVAVLSDRNNHRVNLLF
FT                   NHNKLDIDAEGDYGRGREELGIEASGEPQLMVAYNAQFLIDALAPIEGAVRIKLSGPTS
FT                   PSLVQAVEDSGYLAVVVPLRV"
     gtggaagttc gcatccccaa acgtaccctt gccgaaggac tatccattct agagcggatc        60
     atccccagcc gcagctccaa ccctattctg acctatttac ccatggaact ttccgatcag       120
     ggcctaattt tgcgcggaac caacggcgag gtggatatcg aagttaagct acccgccgag       180
     gtacagggca cgggtcaggt gctggtaccg gcccagacct ttgtgcagat tgtgcgcagc       240
     gccccaggtg aactggtgga gttgatcttt gggggcaagg agcgcctaga actgcactcg       300
     ggggccttca acacccagct tgccaccacc ggcccggacg gttaccccga gctatcgttt       360
     ggcccgccag gccctgaaaa aatcgcggct tctcgcctgg cccaggccat cacccgtgtg       420
     cgctacgcgg ccagcaccga ggagttccgg gccatcttcc gtggggtgca gatcgagatg       480
     tctcccacca gtttgcgggc agtggcctcc gacggctacc gtctggcctg ttacgacctg       540
     cccatgcagc ttcaaacccg caagctggtt attccggctc ggagtgccga cgagatcgtg       600
     cgggttttca aggatgccca gggcgaggtg gccctggcgg tggccgaggg caccctgacg       660
     ctggtgggtg aggcggtgcg gatgtcggtg aagctgatgg agggcgaatt ccccgactat       720
     gggcgggtca ttccgcagag ctttgtactg gaggccacct tgcaggccga ggccttgcgc       780
     gagagcctaa agcgggtagc ggtgctgtcg gatcgcaaca accaccgcgt caatcttctg       840
     tttaatcaca acaagcttga tatcgatgcc gagggcgatt atggccgggg cagggaagag       900
     ctcggcatag aggcctcggg tgaaccccag ctaatggtgg cttacaacgc gcagttcttg       960
     attgatgccc tggcccccat cgagggggcg gtgcggatca aactatccgg ccctaccagc      1020
     cccagcttgg tgcaggcggt ggaggatagt ggctacttag cggtggtggt gccgctacgg      1080
     gtctga                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page