(data stored in ACNUC7421 zone)

EMBL: CP001743.PE201

CP001743.PE201       Location/Qualifiers
FT   CDS_pept        176028..177125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0203"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="TIGRFAM: alanine racemase; PRIAM: Alanine racemase;
FT                   PFAM: alanine racemase domain protein; InterPro
FT                   IPR000821:IPR011079:IPR001608; KEGG: bcy:Bcer98_1563
FT                   alanine racemase; COGs: COG0787 Alanine racemase; SPTR:
FT                   Q8ELK1 Alanine racemase 2; PFAM: Alanine racemase,
FT                   N-terminal domain; Alanine racemase, C-terminal domain;
FT                   TIGRFAM: alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26983"
FT                   /protein_id="ADD26983.1"
FT                   /translation="MRPAWLEINLDALAHNYNLLRSRAGNTQVIGVVKANAYGHGAVEV
FT                   GKELLRLGAWGLAVATTDEARELRKAGIVARILLMGSLHPQQAREVVELDLIPSISTLE
FT                   SAEALNALGKPVTVHLEFDTGMGRVGFQPEEAPQVKEHLVRYENLLVQGIYSHFADAEE
FT                   DVLWTKEQIAHFKQVQQVFGPGYFYHLCNTAGTFNFGEYGLSAVRPGIGLYGLLPHLGL
FT                   KPIARLLAKPTQVKELPPGRRIGYSGLYTTQGREWIATLPVGYADGIPRLVFNRATVRY
FT                   YPDDQPCTCPVVGRVSMDQITVKLPGPVGLEQVFEVVTPDFDPTSSLWGWAELTGTVSY
FT                   EPAVRLAARLPRVYLRDGTEVARVG"
     atgcggcctg cctggctgga aatcaacctc gatgctttag cccacaacta caacctgctg        60
     cgctcccgag ctggaaatac ccaggtgatc ggtgtggtca aggccaacgc ctatgggcat       120
     ggggcggtgg aggtgggcaa ggaactgctg cgcctggggg cctgggggct ggcggtggcc       180
     accaccgacg aggcccgcga gctgcgcaag gcgggcattg tggcccgtat cctgctgatg       240
     gggagtctgc acccccagca ggccagggag gtggtcgagc tggatctgat cccttccatc       300
     tcgaccctcg agagcgccga ggccctcaac gccctgggta agccggtgac ggtgcacctc       360
     gagttcgaca ccggcatggg ccgggtgggc ttccagcccg aagaagcccc acaggtcaaa       420
     gaacacttgg ttcgctatga aaacctgctc gtccagggca tctactccca ctttgccgat       480
     gctgaggagg atgtgctctg gactaaagag caaattgctc atttcaagca ggtgcagcag       540
     gtgtttgggc cgggctactt ttaccacctg tgcaatacgg ccggaacttt taattttggc       600
     gaatacggcc tgagtgcggt gcgtccgggc atcggcctgt atggcctcct gccccacttg       660
     ggcctgaagc ccattgcccg cctgctggcc aaacccaccc aggtcaaaga gctgccgccg       720
     gggcgcagaa tcggctacag cggactctac accacccagg gccgggaatg gatcgccacc       780
     ctgccggtgg gctacgccga tggcatcccc cgcctggtct tcaaccgggc gacggttcgg       840
     tattacccgg atgaccagcc ctgcacctgc ccggtggtgg gccgggtctc gatggatcag       900
     attaccgtga agcttccggg gccggtgggc ctggagcagg tttttgaggt ggtcaccccc       960
     gacttcgacc ccaccagcag cctgtggggc tgggccgagc tgaccggaac tgtcagctac      1020
     gagccggcgg tgcggcttgc ggcccgcctg cccagggtat acctacggga tggaaccgag      1080
     gtggcgcggg tgggatag                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page