(data stored in ACNUC7421 zone)

EMBL: CP001743.PE204

CP001743.PE204       Location/Qualifiers
FT   CDS_pept        178128..178634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0206"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: molybdopterin binding domain; InterPro
FT                   IPR001453; KEGG: molybdenum cofactor synthesis domain
FT                   protein; COGs: COG0521 Molybdopterin biosynthesis protein;
FT                   SPTR: B2YI79 Molybdopterin biosynthesis enzyme; PFAM:
FT                   Probable molybdopterin binding domain; TIGRFAM: molybdenum
FT                   cofactor synthesis domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26986"
FT                   /protein_id="ADD26986.1"
FT                   /translation="MIRVGILTISDREARGESEDHAYAALRESLALGPYEIANYEIIPD
FT                   EPAQIKRVLRLWADRDGLDVILTLGSIRLSNRDHAPEATREMLEKEAPGIAELIRMETY
FT                   KKNPLAALSRGVAGVRGKTLIINLPGGPQGSKDSLEVILPLIPEAVQRITGRPVAHLAN
FT                   GFSFD"
     atgattcgag tcggcatcct taccatttcc gatcgtgaag cccgcgggga gagcgaagac        60
     cacgcttatg cggcgttgcg cgagagcctg gccttaggcc cctacgagat tgccaattac       120
     gagattatcc ccgatgagcc ggcccagatt aagcgggtgt tgcgcttgtg ggccgaccgc       180
     gatgggctgg acgtgatctt gacactgggc agcatccgcc tcagcaaccg cgatcacgcc       240
     ccggaggcca cccgcgagat gctggagaaa gaggcgcccg ggattgcgga gcttatccgc       300
     atggaaactt acaagaaaaa ccctttagca gcgctatccc gtggggtggc gggcgtgcgg       360
     ggcaaaaccc tgattatcaa cctaccggga gggccgcagg gcagcaagga ctccctcgag       420
     gtcatcctgc ccctcattcc cgaggcggtg cagcgcatca caggccgccc ggtggcccat       480
     ctggccaacg gcttttcctt cgactga                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page