(data stored in ACNUC7421 zone)

EMBL: CP001743.PE205

CP001743.PE205       Location/Qualifiers
FT   CDS_pept        complement(178857..179114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26987"
FT                   /protein_id="ADD26987.1"
FT                   /translation="MDYLVAALSVGLVLYFLLRVLQGVLPAGWKARTRSRGLRLLSRSH
FT                   QRCEVCKELLNPAEVAALRQGRRKCPEMARCPYQRSRWLN"
     gtggattatt tggtcgccgc attatcggtt gggctggtgc tctattttct cctccgggtc        60
     ttgcaggggg tgctgccggc aggctggaag gcccgcaccc gctcgcgcgg gctgcgcctg       120
     ctgagccggt cgcatcagcg ctgtgaggtc tgcaaggaac tgctcaaccc cgcggaggtt       180
     gccgctttac gccagggccg acgcaaatgc ccggagatgg cccgctgccc ctaccagcgg       240
     agccggtggc tgaactaa                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page