(data stored in ACNUC7421 zone)

EMBL: CP001743.PE207

CP001743.PE207       Location/Qualifiers
FT   CDS_pept        complement(181443..182615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0209"
FT                   /product="Threonyl/alanyl tRNA synthetase SAD"
FT                   /note="PFAM: Threonyl/alanyl tRNA synthetase SAD; SPTR:
FT                   A6BHW2 Putative uncharacterized protein; InterPro
FT                   IPR012947:IPR002318; COGs: COG2872 metal-dependent
FT                   hydrolase related to alanyl-tRNA synthetase HxxxH domain;
FT                   KEGG: sus:Acid_1476 alanyl-tRNA synthetase; PFAM: Threonyl
FT                   and Alanyl tRNA synthetase second additional domain; tRNA
FT                   synthetases class II (A)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26989"
FT                   /protein_id="ADD26989.1"
FT                   /translation="MRAYWDHPYESQFEAQVVRAWSEGGKHFAVLDQTLFYPTSGGQAC
FT                   DTGHLGGVAVLEVLEDAKATGPVIHRLESPLLEGQRVVGQLDWARRYRHMQRHTAEHML
FT                   GQAFLRAAGWNVVAVNMSNPVCTMDFDGPPDEAVIRQAEALANWAVYANTAVRTYFIND
FT                   AEAPAHGLRRAPKVAGLIRVVEIEGWDRVACGGLHVARTGEAGPIKITRFERYKGGTRV
FT                   YFMAGWEALELFEQEHRLLARLGEWFSSSPLEVEKPIGNLREEWRRARAENAALKDELA
FT                   ERIMRDLLTEFPTQTMAAQVPHSVLDMVGKRLAEWPGVLALLVAQAEDKARYVLLKHPS
FT                   RSEDLQAIWEEVLKPLGARGGGALVKLGVMPLKSLHPALLAFQRYLAQER"
     gtgcgcgctt actgggatca cccctacgaa agccagttcg aggcccaggt ggtgcgggcc        60
     tggagcgagg gcggcaagca ctttgccgtg ctggatcaga cccttttcta ccccacctcg       120
     ggcggtcagg cctgtgatac cggccacctg ggtggggttg cggtgctgga ggtgctcgag       180
     gacgccaagg ccaccggccc ggtgatccac cggctggaaa gccccctttt ggaggggcag       240
     cgtgtggtgg gccagctcga ctgggcccgg cgctaccggc atatgcaacg ccacaccgcc       300
     gagcacatgc tgggccaggc ctttttgcgg gccgcaggct ggaacgtggt ggctgtgaat       360
     atgagcaacc cggtctgcac catggacttc gacggcccac ccgacgaagc ggtgatccgc       420
     caggccgagg ccctggccaa ctgggcggtg tacgccaaca cagcggtgcg tacctatttc       480
     ataaacgacg cggaggcccc agcccacggc ctgcgccgcg cccccaaggt ggccgggctt       540
     atccgggtgg tggagattga aggctgggac agggtggcct gcggcggcct gcacgtggcc       600
     cgcaccggcg aggctggccc catcaaaata acccgcttcg agcgttacaa aggcggcacg       660
     cgcgtctact tcatggccgg ctgggaggcc ctcgagctct ttgagcagga gcaccgcctg       720
     ctggcccgcc tgggggagtg gtttagctcg agccccctcg aggtcgaaaa acccatcggc       780
     aacctgcgcg aggagtggcg cagggcgcgg gccgaaaacg ccgccctcaa ggacgagctg       840
     gccgagcgca ttatgcgcga cctgctgacc gagttcccca cacagaccat ggccgcccag       900
     gtgccccaca gcgtgctgga catggtgggc aagcgcctgg ccgagtggcc gggggtgctg       960
     gccctgctgg tagcccaggc cgaggacaaa gcccgctatg tcctgctcaa acaccccagc      1020
     cgcagcgaag acctgcaagc catctgggag gaggtgctca agccgctggg ggcccggggc      1080
     ggaggggcgc tggtcaagct gggggttatg cccctgaaat cactccaccc ggctttgtta      1140
     gcctttcagc gatacctggc ccaggagcgc taa                                   1173
//

If you have problems or comments...

PBIL Back to PBIL home page