(data stored in ACNUC7421 zone)

EMBL: CP001743.PE208

CP001743.PE208       Location/Qualifiers
FT   CDS_pept        complement(182638..184518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0210"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="5.6.1.1"
FT                   /note="TIGRFAM: ATP-dependent metalloprotease FtsH; PRIAM:
FT                   Microtubule-severing ATPase; PFAM: peptidase M41; peptidase
FT                   M41 FtsH extracellular; AAA ATPase central domain protein;
FT                   InterProIPR011546:IPR000642:IPR003959:IPR003593:IPR
FT                   003960:IPR005936; SPTR: A1HRR8 ATP-dependent
FT                   metalloprotease FtsH; KEGG: eba:ebA4823 cell division
FT                   protein; COGs: COG0465 ATP-dependent Zn protease; SMART:
FT                   AAA ATPase; PFAM: Peptidase family M41; FtsH Extracellular;
FT                   ATPase family associated with various cellular activities
FT                   (AAA); TIGRFAM: ATP-dependent metalloprotease FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26990"
FT                   /protein_id="ADD26990.1"
FT                   /translation="MNRLPFNLWFILLAAILIAWAFSLTSHQQPANQVAYTTFLNEIDQ
FT                   GRVAKITVDGRQLNVTRREDGDQYVTFAPGPIDTSTIREWGDKKIQVDIAAPRRENPLL
FT                   GFLIPLLLIGLLIGVFFFFSRNRGPSGDNAFSFTKSRAKVLTEAPKTSFKDVAGCEEAK
FT                   EELKEIVEFLKAPARFHEMGARIPKGVLLVGPPGSGKTHIARAVAGEAKVPFIAASGSD
FT                   FVEMFVGVGAARVRDLFETAKRHAPCIIFIDEIDAVGRRRGGGVGGGNDEREQTLNQLL
FT                   VELDGFEKETSIIIMAATNRPDVLDPALLRPGRFDRQVAIDAPDVKGREQILKIHAKGK
FT                   PLAEDVDLSLLARRTPGFVGADLENLLNEAALLAARDGRKKITMKDLEEAADRVMMGPA
FT                   KKSMVITPKDREVTAYHEAGHALAAHFLEHADKVHKVTIVPRGRAMGFMMPSRQDTLHW
FT                   SKKRLTDQIAVALAGRVAEELIFDDVTTGAENDFRQATDLARRMITEWGMHPDFGMVAY
FT                   QVREDTYLGGYDTRQYSEDTARRIDEAVQKLLQEQHDRVLGLLTEKREVLERVAQTLLE
FT                   RETLNAEEFVRVVEGEKLERLEPTSETPKDKEEKEPPRVVPKVKPNLGGA"
     atgaaccgcc tgccgttcaa cttatggttt atcctgctgg cagctatcct gattgcctgg        60
     gctttcagcc ttacctcgca tcagcagccc gccaaccagg ttgcctatac cacttttctt       120
     aacgaaattg accagggccg ggtggccaaa attacggttg atggacggca gctcaacgtc       180
     acccgccgcg aggacggcga tcaatacgtc acctttgcgc cgggccccat agacaccagc       240
     accatccgcg agtggggcga caaaaaaatc caggtggata ttgccgcacc cagacgagaa       300
     aatcccttgc tgggattcct gatccctttg ctgctaatcg gtttgctgat cggggttttc       360
     ttctttttct cgcgcaaccg gggcccatcg ggcgacaacg cctttagctt caccaaaagc       420
     cgggccaagg tgctgaccga ggcgcccaaa accagcttca aagacgtggc cggctgcgaa       480
     gaggccaaag aggagctcaa agagatcgtg gagttcctca aagccccggc ccgctttcac       540
     gagatggggg cccgcattcc caagggggtg ctgctggtcg ggccgcccgg ctcgggcaaa       600
     acccatatcg cgcgggcggt ggccggtgag gccaaggtgc cctttatcgc cgcctcgggc       660
     tccgacttcg tggagatgtt cgtgggggtg ggggccgccc gggtgcgcga cctgttcgag       720
     accgccaagc gccacgcacc ctgcatcatc ttcatcgatg aaattgacgc ggtgggccgc       780
     cggcgcgggg gcggcgtggg cggcggcaac gacgagcgcg agcagaccct caaccaactg       840
     ctggtggagc tcgacggctt tgagaaagaa accagcatca tcattatggc agccaccaac       900
     cgcccggacg tgctcgaccc cgcgctgctg cggccgggcc gcttcgaccg ccaggtggcc       960
     attgatgccc ccgatgtgaa ggggcgtgag caaatcctca agattcacgc caagggcaag      1020
     cccctggccg aagatgtgga tctatctttg ctggccaggc gcacccccgg ctttgtggga      1080
     gccgatctgg aaaacctcct caacgaggca gccctgctgg ccgcccgcga tggccgcaaa      1140
     aaaatcacca tgaaagacct ggaagaagcc gccgaccggg tgatgatggg ccccgccaaa      1200
     aagagcatgg tgatcacgcc gaaagaccgc gaggtcaccg cctaccacga ggccgggcac      1260
     gcgctggccg cgcacttcct cgagcacgcc gacaaggtgc acaaggtgac catcgtcccg      1320
     cggggacggg ccatgggctt catgatgccc agccgccagg acaccctgca ctggagcaaa      1380
     aagcgcctga ccgaccagat cgccgtggcc ctggcgggcc gggtggccga ggaactcatt      1440
     ttcgacgacg tgaccaccgg ggccgagaac gacttccgcc aggccaccga cctggcccgc      1500
     cgcatgatta ccgagtgggg gatgcacccc gactttggca tggtggccta ccaggtgcgc      1560
     gaggacacct acctgggtgg ctacgacacc cggcagtact ccgaggacac cgcccggcgc      1620
     attgacgagg ccgtgcaaaa gctgttgcag gagcagcacg accgggtgct gggcctgctc      1680
     accgaaaaga gggaggtgct cgagcgggtc gcgcagacgc ttctggagcg tgagaccctg      1740
     aacgccgaag agtttgtgcg ggtggtggaa ggcgagaagc tggagcgcct cgagcccacc      1800
     agcgaaaccc ccaaggacaa agaggaaaag gagcccccac gggttgtccc caaggtcaaa      1860
     cccaacctgg gcggggcctg a                                                1881
//

If you have problems or comments...

PBIL Back to PBIL home page