(data stored in ACNUC7421 zone)

EMBL: CP001743.PE215

CP001743.PE215       Location/Qualifiers
FT   CDS_pept        192026..192700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0217"
FT                   /product="CRISPR-associated RAMP protein, Csm3 family"
FT                   /note="TIGRFAM: CRISPR-associated RAMP protein, Csm3
FT                   family; PFAM: protein of unknown function DUF324; InterPro
FT                   IPR005537:IPR013412; KEGG: dol:Dole_0742 CRISPR-associated
FT                   RAMP Csm3 family protein; COGs: COG1337 Uncharacterized
FT                   protein predicted to be involved in DNA repair (RAMP
FT                   superfamily); SPTR: Q8TPH9 Putative uncharacterized
FT                   protein; PFAM: RAMP superfamily; TIGRFAM: CRISPR-associated
FT                   RAMP protein, Csm3 family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26997"
FT                   /protein_id="ADD26997.1"
FT                   /translation="MKLLGYKRIHGIIHLRSGLRIGMSKDQMAIGDVDNPVIRNPLTDE
FT                   PYIPGSSLKGKMRYLLEWHLGGKYITESDQYHVYKDEDGPIGRIFGVAPGNDRRSKELA
FT                   QQRGPTRLLVRDAYLTRESKERLEAMTARGGYLTEVKQEVFIPRIGGNANPRTAERVPA
FT                   GAKFAFEMVYRVMDTGDGGQTDQSNFEYVKKALELLQLDGLGGYISRGYGQVELRYEVE
FT                   EK"
     atgaaattac tcggctacaa gcgcatccac ggcatcattc accttagaag cggcctacgc        60
     atcggcatga gcaaagacca gatggccatc ggggacgtgg ataacccggt catccgcaat       120
     cccctgaccg atgaacccta catccccggc tcctcgctca agggcaagat gcggtatctg       180
     ctagagtggc acctcggcgg gaagtacatc accgagtccg accagtacca tgtttacaag       240
     gacgaggatg gccccatcgg gcgcattttc ggtgtagctc ccggcaacga ccgtcgcagt       300
     aaagaactag ctcaacagcg cggtcccacc cgcctcctgg tgcgcgatgc ttacctaacg       360
     cgcgaatcta aagaaagact cgaggccatg accgcccgcg gcggctacct gaccgaggtc       420
     aagcaagagg tgtttatccc ccgcattggc ggcaacgcca acccccgcac cgccgagcgt       480
     gtaccggccg gggccaagtt tgccttcgag atggtctacc gggtgatgga caccggcgac       540
     ggcggccaga ccgaccagag caacttcgag tatgtaaaga aggccctcga gctgctgcaa       600
     ctcgacgggc tgggcggcta catcagccgg gggtacgggc aggtggagct gcgttacgaa       660
     gtcgaggaaa aatga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page