(data stored in ACNUC7421 zone)

EMBL: CP001743.PE216

CP001743.PE216       Location/Qualifiers
FT   CDS_pept        192697..193584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0218"
FT                   /product="CRISPR-associated RAMP protein, Csm4 family"
FT                   /note="TIGRFAM: CRISPR-associated RAMP protein, Csm4
FT                   family; SPTR: A6DE73 Putative uncharacterized protein;
FT                   InterPro IPR005510; COGs: COG1567 Uncharacterized protein
FT                   predicted to be involved in DNA repair (RAMP superfamily);
FT                   KEGG: neu:NE0120 hypothetical protein; PFAM: RAMP
FT                   superfamily; TIGRFAM: CRISPR-associated RAMP protein, Csm4
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26998"
FT                   /protein_id="ADD26998.1"
FT                   /translation="MRVRAFHLKLSSITAPPRAPTLWGHLAWWVRYTQGEEKLKEWLEA
FT                   FQHDPPFLFSSAFPTGYLPRPYLPQLQVEDTQARKALKKIRYLSLKTFARVIQEGEQAL
FT                   RDAPELKEGKAPKVTLASQTRVGINRTTGTAQEGILFTDRVYWLNDKAQQQTWTVYAQV
FT                   RQQADYLEQALREVGTFGYGGKASVGLGRFEVVDTQELELPEAENPTHYVILSPTLPQG
FT                   EGFYALETYWGRLGGHFALAETPFKRPYLRAVEGSVFKEKPKSGLLDVTPAPAPEAGVR
FT                   VWEYLYPFCLGVRI"
     atgagggttc gggcctttca tctaaagctc tccagcatca ccgccccgcc cagggctccc        60
     accctgtggg gccacctggc ctggtgggtg cgctataccc agggagagga aaagctgaaa       120
     gagtggctcg aggctttcca gcacgacccg cccttcctgt tctcctcggc cttccccacc       180
     ggttacctgc cccgccccta cctcccccag cttcaggtgg aggacaccca ggcgcgcaaa       240
     gccctcaaga agatccgcta cctgagccta aagaccttcg ccagggtcat ccaggaaggc       300
     gaacaagcgc tacgcgatgc acctgaactc aaagagggaa aagcccccaa ggtcaccttg       360
     gcctcccaga cccgcgtggg catcaaccgc accaccggca ccgcgcagga gggcatcctc       420
     ttcaccgacc gggtgtactg gctgaacgac aaagcgcaac agcagacctg gacggtctac       480
     gcccaggttc ggcagcaggc cgactatttg gagcaagccc tgcgggaggt gggcaccttt       540
     ggttacggcg gtaaggccag cgtggggctg ggccgcttcg aggtagtaga cacccaggaa       600
     ctcgagctgc ccgaggccga gaaccccacc cactacgtca tcctatcgcc cactttgccc       660
     cagggcgagg ggttttatgc cctcgagacc tactggggcc gcctgggcgg gcacttcgcc       720
     ctggccgaga cccccttcaa gcgcccctac ctgcgggcgg tggagggaag cgtgttcaag       780
     gagaagccca aaagtggcct gctggacgtg accccagcgc cggccccgga agcgggcgtg       840
     cgggtgtggg agtatctcta tcccttctgc ttgggggtgc ggatatga                    888
//

If you have problems or comments...

PBIL Back to PBIL home page