(data stored in ACNUC7421 zone)

EMBL: CP001743.PE219

CP001743.PE219       Location/Qualifiers
FT   CDS_pept        195009..195389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0221"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; SPTR: A3Z442
FT                   Putative uncharacterized protein; InterPro IPR002716; COGs:
FT                   COG3742 conserved hypothetical protein; KEGG: nha:Nham_4577
FT                   PilT protein-like; PFAM: PIN domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27001"
FT                   /protein_id="ADD27001.1"
FT                   /translation="MVLDSSVLVQLIFAEPGHRETLEHILEAEVRVVGAPTLVEVGMVL
FT                   TSRLGPDNLYLLDELLMRLEARVVPFEASHAHQALSAFRRCGKGRHPAALNFGDCLSYA
FT                   VAKVAGMPLAYVGDDFAQTDLA"
     atggtgctgg acagttcggt tctggtacag cttatttttg ccgagccagg gcatcgggag        60
     acgctcgagc acattcttga ggccgaggtg cgcgtggtgg gggcacccac gctggtcgag       120
     gtgggtatgg tgttgaccag tcggttgggg ccggacaacc tgtacctgct ggacgaactt       180
     ctgatgcgcc tcgaggcccg ggtggttcct ttcgaggcaa gccatgcgca ccaagccctc       240
     tcggccttcc gccgctgcgg caagggccgc caccctgcgg ccctcaactt tggcgactgc       300
     ctgagctacg cggtggctaa ggtggcgggg atgcccctgg cctacgtagg cgacgacttc       360
     gcccagaccg acctggcatg a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page