(data stored in ACNUC7421 zone)

EMBL: CP001743.PE22

CP001743.PE22        Location/Qualifiers
FT   CDS_pept        19639..20007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0022"
FT                   /product="Rhodanese domain protein"
FT                   /note="COGs: COG0607 Rhodanese-related sulfurtransferase;
FT                   KEGG: gme:Gmet_3122 rhodanese-like protein; SPTR: A6CTX9
FT                   YrkF; SMART: Rhodanese domain protein; PFAM: Rhodanese
FT                   domain protein; InterPro IPR001763; PFAM: Rhodanese-like
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26804"
FT                   /protein_id="ADD26804.1"
FT                   /translation="MKAIASLVVFLVASAGLAQGFKVVTVDDLYRALPDPKTFVIDVRT
FT                   PQEYARGHVPGAVNWPLQQIEQWWSKVPKDRVVYVKCNTQNRSRVAVQYLLSRGYRNLN
FT                   LVTGGIQAWMARGYPTTR"
     atgaaggcca tagccagcct ggtggttttt ctggtggcct ccgcggggct ggcccagggc        60
     ttcaaggtcg taaccgtgga cgacctctac cgcgcgctgc ccgatcccaa aaccttcgtt       120
     attgatgtgc gcaccccgca ggagtatgcc cgggggcacg ttcccggagc ggttaactgg       180
     cccctgcaac agatcgagca atggtggagc aaagtcccca aggatcgggt ggtctacgtc       240
     aagtgtaaca cccagaaccg cagcagggtt gccgtgcagt acctgctctc cagggggtat       300
     cggaatctga acctggttac cgggggcatt caggcctgga tggcccgcgg gtatcccacc       360
     acccgataa                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page