(data stored in ACNUC7421 zone)

EMBL: CP001743.PE220

CP001743.PE220       Location/Qualifiers
FT   CDS_pept        195386..196174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0222"
FT                   /product="CRISPR-associated protein Cas6"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas6; InterPro
FT                   IPR010156; COGs: COG5551 conserved hypothetical protein;
FT                   SPTR: A0YIK9 Putative uncharacterized protein; PFAM:
FT                   Uncharacterized conserved protein (DUF2276); TIGRFAM:
FT                   CRISPR-associated protein Cas6"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27002"
FT                   /protein_id="ADD27002.1"
FT                   /translation="MILAALILPLEGPTRPDPDGWRGLVYGLLKEIDPELHAAQHNPFS
FT                   LGLGGALGQWWVRIAFLEEGLYARLSPHLFGLAGQTVRLKEAFQVRAVLQEAHPWAGVS
FT                   TYPKLFQGQATASLGLQFASPTFFRRKGHSYPLPEPRLVFESLTQRWNAFAPVKVPQEV
FT                   QEAWERLLVGQFQGRTHHIAPNQDERGVGFVGRVVYYLPKASPTEAQWLQALGRFAFYA
FT                   GVGAKTSLGFGRVRMFDPLQQERRPDESEQGALTGTVGGV"
     atgatactcg cagcgctgat actccccctc gagggcccca cccgccccga ccccgacggt        60
     tggcgtggcc tggtgtatgg cctgcttaag gagatagatc ccgagctgca cgcggcccag       120
     cacaacccct tcagcctggg actgggcgga gccctggggc agtggtgggt gcggattgct       180
     tttttggagg agggcctgta tgcccggctc tcaccccacc tgtttggcct ggcaggccag       240
     accgtgcggc tcaaggaggc cttccaggtg cgcgcggtgc tgcaagaagc gcacccctgg       300
     gccggcgtga gcacctatcc caagctcttc cagggccaag ccaccgccag cctggggctt       360
     cagtttgcca gccccacctt tttccgccgc aaggggcaca gctaccccct gcccgagccc       420
     cggctggtct tcgagtcgct cacccagcgc tggaacgcct ttgctccggt aaaggtgccc       480
     caggaggtgc aggaagcctg ggaacgcctt ttggtgggcc agttccaggg ccgcacccac       540
     cacatcgccc ccaaccagga cgagcggggg gtgggctttg tgggccgggt ggtctactac       600
     ctgcccaaag ccagccccac cgaggcccag tggctccagg ccctggggcg ctttgccttt       660
     tacgccgggg tgggggccaa gaccagcctg gggtttgggc gggtgcggat gtttgaccca       720
     ttgcaacaag aaaggaggcc cgatgaatca gaacaaggag cgcttacggg aactgtgggc       780
     ggagtataa                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page