(data stored in ACNUC7421 zone)

EMBL: CP001743.PE221

CP001743.PE221       Location/Qualifiers
FT   CDS_pept        196128..197594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0223"
FT                   /product="CRISPR-associated protein, TIGR02710 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, TIGR02710
FT                   family; InterPro IPR014082; KEGG: bpt:Bpet4246 hypothetical
FT                   protein; PFAM: CRISPR-associated protein (Cas_Cas02710);
FT                   TIGRFAM: CRISPR-associated protein, TIGR02710 family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27003"
FT                   /protein_id="ADD27003.1"
FT                   /translation="MNQNKERLRELWAEYKTLIRQESANRAGSSPQSQKAKELYDTQIW
FT                   PLTKEGFTDRGQQQYVASFHTVGTTAEPIILSVRALDAEKVYLLHTKDTEKLCGRIERE
FT                   LGWGVERIKTLLVGRSDPEDIYKQVRQKVDELPPDAAIAFDPTGGTKAMVAGLAMFAFS
FT                   LAEEGRTAHVYYVDNEEYDDELRRPVAGTEFLKRLENPREVIPDWIYHRAKDAYKRGDF
FT                   SLAKQLFDQAKDREGRAHSLEAVLSEAYESLDAAQFKQAKDRLNDLLELLQKPAHRQSF
FT                   LTRNIATIERQKEALEVVVQLTEALSAKDKSIAPLADPQQVACVLAALGFMTEKRLKTG
FT                   RIAEAVLLRYRALELFLQHRLALRGFDTEKPDFPGLCAANHTSIEDLQEKYQAERKAAK
FT                   AGSDDKLIEKNAVDFITAFFLLRALGDGPALAVNVNKVLGLTKTRNASVFAHGFTLPTE
FT                   DNAKNLSEVLVALVQSGGLPEVRFEPIPLS"
     atgaatcaga acaaggagcg cttacgggaa ctgtgggcgg agtataaaac ccttataagg        60
     caggagagtg caaatcgagc ggggtcttcc cctcagagcc aaaaagctaa agagctgtac       120
     gatacgcaaa tctggcccct cacaaaagag ggttttaccg atcgaggcca gcagcagtat       180
     gtcgcgtcct ttcacacagt tggcacaaca gcggaaccga tcattctttc ggttcgggcg       240
     ctggatgcag agaaagtgta tttgttgcat accaaagaca ccgaaaagct ctgtgggcgg       300
     attgagaggg aattggggtg gggggtggag cgcatcaaga ccctcctggt tggccgcagc       360
     gacccagaag acatttataa acaggtgcgg caaaaggtag acgaacttcc cccggatgcg       420
     gccattgcct tcgacccaac tggaggcacc aaggcgatgg tggctgggtt ggcgatgttt       480
     gccttctcgc tggccgagga agggcgcacg gcgcatgttt actacgttga caacgaagaa       540
     tacgacgatg agttgcgccg tcctgtcgca ggaacagagt ttttgaagcg cctcgagaac       600
     ccccgtgagg tcatacccga ctggatatac caccgcgcca aagatgccta caaacgaggt       660
     gatttttcgc ttgcaaaaca gctttttgac caagctaaag atcgtgaagg gcgagcgcat       720
     agcctcgagg cggtgttatc ggaggcttac gaatctttgg atgccgccca gttcaagcag       780
     gccaaagaca ggcttaatga tctgctcgag ctactacaaa aacccgcaca taggcaaagt       840
     ttccttacta gaaatatagc taccatcgag cgtcaaaaag aagccctcga ggtcgttgtt       900
     cagcttaccg aggcactttc tgccaaagac aagagcatag cgcctctggc agaccctcaa       960
     caagtggctt gcgtgctggc agccctcggt tttatgaccg aaaagagact aaagacgggc      1020
     cgtatagccg aagccgtgct cttgcgctac cgcgccctcg agctgttctt gcaacaccgc      1080
     cttgcgctca ggggttttga cacagagaag ccagactttc cgggattgtg cgctgcaaac      1140
     catacctcta tcgaagatct ccaggagaag taccaagctg agcgcaaagc tgcaaaggct      1200
     ggatcagacg ataagctgat agaaaaaaac gcagtagact ttatcaccgc cttctttttg      1260
     ctccgggcct taggggatgg gccggcttta gccgtcaatg taaacaaggt gctcggacta      1320
     actaaaaccc gtaacgcctc ggtttttgcc cacggcttta cgcttcccac agaggacaac      1380
     gccaaaaacc tgtctgaagt gttggtggct cttgttcaaa gtggaggctt gccagaggtc      1440
     aggttcgagc ccattcccct gtcgtga                                          1467
//

If you have problems or comments...

PBIL Back to PBIL home page