(data stored in ACNUC7421 zone)

EMBL: CP001743.PE222

CP001743.PE222       Location/Qualifiers
FT   CDS_pept        197591..198562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0224"
FT                   /product="CRISPR-associated protein Cas1"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas1; PFAM:
FT                   protein of unknown function DUF48; InterPro IPR002729;
FT                   KEGG: msu:MS0981 hypothetical protein; COGs: COG1518
FT                   Uncharacterized protein predicted to be involved in DNA
FT                   repair; SPTR: A1HM55 CRISPR-associated protein Cas1; PFAM:
FT                   Protein of unknown function DUF48; TIGRFAM:
FT                   CRISPR-associated protein Cas1"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27004"
FT                   /protein_id="ADD27004.1"
FT                   /translation="MTLHLTEQSSTLRLSQGRLRVELDEQTLAELPARKVRGVVVWGNV
FT                   RLTTPALAFLLRQGVPVLYATLEGQLYGQAQAPQSLAPEVLRAQLLAQQNPLPLAQGFL
FT                   LGKLRSGQMLLERLARQAPITPQQAEIEAALEALPQARSLEALRGIEGNAARAYFAGLQ
FT                   AVLAPYGFSGRNRRPPTDAVNAALSYGYMVLLGRVLLALGIAGLHPELGLLHTEGRRVP
FT                   ALAFDLMEEFRVSVVDAVVIAAFLRSELTPQQHSEARNGGVYLNEAGRKALLRRLEERF
FT                   SQEAQHPKGFRKPYQELIETQAARLKAAILGREPYTPFYLWR"
     gtgaccctcc acctcaccga gcaatcctcc accctgcgcc tctcccaggg ccgcctgcgg        60
     gtggagctcg acgagcaaac cctggccgaa ctgcccgccc gcaaggtgcg gggggtggtg       120
     gtctggggga atgtgcggct gaccaccccg gccctggcct tcctgttgcg gcagggggtt       180
     ccggtgctgt acgccacctt ggagggccag ctttacgggc aggcccaggc gccccaaagc       240
     ctcgcacccg aggtgctgcg ggcccagctt ctggcacagc aaaaccccct tccgctggcg       300
     cagggctttt tgctgggcaa gctgcgttcg gggcagatgc tgctcgagcg cctcgcgcgc       360
     caggccccca tcacacccca gcaggccgag atagaggccg ccctcgaggc gctgccccag       420
     gcccggagcc tcgaggccct gcgcggtatc gagggcaacg ccgcccgcgc ctactttgcc       480
     gggctgcaag cggtactagc gccctacggc ttttccgggc gcaaccgccg cccccccacc       540
     gatgccgtga atgccgcgct ctcctatggc tacatggtgt tgctgggccg ggtgttgctg       600
     gccctgggca tagctggcct gcaccccgag ctgggcctgc tgcacaccga gggccgccgg       660
     gtccccgccc tggccttcga cctgatggag gagtttaggg tttcggtggt ggacgcggtg       720
     gtaattgcgg cctttttacg cagcgagcta accccccagc agcacagcga ggcccgcaac       780
     ggcggggttt atctgaacga agccgggcgc aaggcgctgc ttaggcggct cgaggagcgc       840
     tttagccagg aggcccagca ccccaagggc ttccgcaagc cctaccagga actcatcgaa       900
     acccaggcgg cccgcctcaa ggcggccatc ctgggccgcg aaccctacac ccccttctac       960
     ctttggaggt aa                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page