(data stored in ACNUC7421 zone)

EMBL: CP001743.PE223

CP001743.PE223       Location/Qualifiers
FT   CDS_pept        198677..198841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0225"
FT                   /product="CRISPR-associated protein Cas2"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas2; PFAM:
FT                   protein of unknown function DUF196; InterPro IPR003799;
FT                   KEGG: sfu:Sfum_1356 CRISPR-associated protein Cas2; SPTR:
FT                   A0YRL5 Putative uncharacterized protein; PFAM:
FT                   Uncharacterized ACR, COG1343; TIGRFAM: CRISPR-associated
FT                   protein Cas2"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27005"
FT                   /protein_id="ADD27005.1"
FT                   /translation="MPDERFYTIAYDIPDDGRRVKVANVLKSFGERVQLSVFECWLAPG
FT                   QLQQLKQLL"
     atgcccgacg aacgcttcta caccattgcc tacgacatcc ccgacgatgg ccgccgggtc        60
     aaggtggcca acgtgctcaa gagctttggc gagcgggtac agctttcggt gttcgagtgc       120
     tggctggccc cagggcagct ccagcagctc aagcagcttt tgtaa                       165
//

If you have problems or comments...

PBIL Back to PBIL home page