(data stored in ACNUC7421 zone)

EMBL: CP001743.PE225

CP001743.PE225       Location/Qualifiers
FT   CDS_pept        200221..201432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0228"
FT                   /product="CRISPR-associated protein, TIGR02710 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, TIGR02710
FT                   family; InterPro IPR014082; KEGG: sat:SYN_02245 putative
FT                   cytoplasmic protein; SPTR: A1HM57 Putative uncharacterized
FT                   protein; PFAM: CRISPR-associated protein (Cas_Cas02710);
FT                   TIGRFAM: CRISPR-associated protein, TIGR02710 family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27007"
FT                   /protein_id="ADD27007.1"
FT                   /translation="MQEQLNTVLILGVGQTLEPLEFALTEHTPQGVIFIASQDSQVVSA
FT                   ELIQRYGEALRFHTLLLDDPEDLGEVFRKGRLALQKALEWEARAIVADITGGTKTMSAG
FT                   LVLALTGQGVTFSYVGGQARDGQGRVKSGSERLRLLEDPTYRYGLREWEGFRRAWNQCD
FT                   YQAAQAFLDALLARPLTPSEKRFYEHLKGITEGMLEWDLFYHKAAWQKLERHLEPTLTI
FT                   AEAWGHGGKVRVLQELQQAQARLRAILDREGKPTFALLADLLANAQRRASRGRHDDALA
FT                   RLYRAVELAAEADLYERHQIVLSDPKSYPQAAQHLAQQIQRATGLKDRLSLAATIDGVL
FT                   GQSQTLPQRLYAAYLGELGNLLQARHNSILAHGFTPVKQESWEKLYKSLQGLGLEAAPA
FT                   WPTW"
     gtgcaggagc aactaaacac agttttgata ctgggggtgg ggcagaccct ggagcccctc        60
     gagtttgccc tgaccgagca caccccgcag ggggtgattt ttatagccag ccaggattcg       120
     caggtggtgt cggcagagct tatccaacgc tatggggaag cgctgcgctt tcacaccctg       180
     ctgctcgacg accccgaaga cctgggcgag gtgtttcgca aggggcgctt ggcactgcaa       240
     aaggccctcg agtgggaggc gcgggccatt gtggccgata ttaccggggg caccaaaacc       300
     atgtcggcgg ggctggtgct ggcccttacc gggcagggcg ttacctttag ctacgtgggc       360
     ggccaggccc gcgacggtca ggggcgggta aaaagcggca gcgagcggct gcggctgctg       420
     gaagacccca cctaccgcta cggcctgcgc gagtgggagg gtttccggcg ggcctggaac       480
     cagtgcgact accaggccgc acaggcgttt ctggacgcac tgctggcccg gcccctgacc       540
     ccctccgaga agcgctttta cgagcacctg aaggggatta ccgaaggcat gctggagtgg       600
     gacttgtttt accacaaggc ggcctggcag aagctggaga gacacctcga gcccaccctt       660
     accattgccg aagcctgggg gcacgggggc aaggtgcggg tgttgcagga attgcagcag       720
     gcccaagccc ggctgcgggc catcctggat cgggagggca agcccacctt tgccctgctg       780
     gccgaccttt tagccaacgc ccagcgccgg gcttccaggg gccgccacga cgacgcgttg       840
     gcccggctgt accgggcggt ggagctggcc gctgaggccg acctgtacga gcggcaccag       900
     attgtgctga gcgaccccaa aagctatccg caggcagccc agcaccttgc tcaacagatt       960
     cagagggcca ccggcctcaa ggatcggctg tccctggcgg ctaccataga tggggtattg      1020
     gggcagtccc agaccctacc ccagcggctc tacgcggcct acctgggcga gctagggaac      1080
     ctgctccaag cgcgtcacaa cagcattctg gctcatgggt ttaccccggt gaagcaggaa      1140
     tcgtgggaga aactttataa gtcccttcag ggcttgggcc tcgaggccgc ccccgcctgg      1200
     cccacctggt ag                                                          1212
//

If you have problems or comments...

PBIL Back to PBIL home page