(data stored in ACNUC7421 zone)

EMBL: CP001743.PE229

CP001743.PE229       Location/Qualifiers
FT   CDS_pept        204491..204829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27011"
FT                   /protein_id="ADD27011.1"
FT                   /translation="MQASLKVTEKLLLLDLGEVRRLMTQDGPCLARYIAVAQEARIRCV
FT                   RPARARLMRLGVAPGETLLYTLPGDPLDFEQEGANLLLPGLRLYLEGPPEFVETPLYAW
FT                   VEGGSGCG"
     atgcaggcca gcctgaaagt aaccgagaag ctgcttttgc tcgacctggg agaggtgcgc        60
     cgtctgatga cccaggacgg cccctgcctg gcgcgctata tagccgtggc gcaggaggcc       120
     cgcatccgct gtgtccgccc tgcgcgggcc cggctgatgc ggctgggggt tgcccctggc       180
     gagaccctgc tgtacaccct gccgggggat ccgctggact tcgagcagga aggtgccaac       240
     ctgttgctgc cagggctccg gctgtatctg gaggggccac cggagtttgt agaaaccccg       300
     ctgtatgcct gggtggaagg ggggagcgga tgcgggtag                              339
//

If you have problems or comments...

PBIL Back to PBIL home page