(data stored in ACNUC7421 zone)

EMBL: CP001743.PE230

CP001743.PE230       Location/Qualifiers
FT   CDS_pept        204820..205671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0233"
FT                   /product="putative periplasmic substrate-binding protein"
FT                   /note="SPTR: A4U8S8 Putative ABC transporter substrate
FT                   binding protein; COGs: COG0614 ABC-type Fe3+-hydroxamate
FT                   transport system periplasmic component; KEGG: scl:sce7441
FT                   putative periplasmic substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27012"
FT                   /protein_id="ADD27012.1"
FT                   /translation="MRVASLVPAATEILRFLGVEPVGVSHCCAVADKPVLTESILPKGL
FT                   SQAEIDQRVRQAAQAGQSLYRVRTEVLQSLKPDLILTQGVCEVCAVGPSELRQAVDCLS
FT                   FGVPTLSLQGTRLAHLWDDLRAVAAATGVSAEAGIEELQGRLERVRRAVAGRKRPRVAF
FT                   VEWLEPPFLGGHWVPDLVEAAGGAPLGASPEAPSFRTTWEEIAALQPEVVLFSFCGYGL
FT                   EAALRDLAGWANPLSGVECWALDSAYFCALTPQVVQGVEILAGILHPGAWPAPAPAEAV
FT                   RR"
     atgcgggtag ccagcctggt gcctgcggcc accgagattc tgcgcttttt gggggtggag        60
     ccggtggggg tctcgcactg ttgcgccgtg gcagacaagc ccgtgctgac cgagagcatc       120
     ctacccaaag gactttcgca agccgagata gatcagcggg tgcgtcaggc cgcccaggcc       180
     ggccagagcc tgtaccgggt gcgcacggag gtgctccagt ctctgaagcc cgatctgatc       240
     ctgacccagg gggtttgcga ggtgtgtgcg gtggggccca gcgagctgcg ccaggcggtg       300
     gactgcctat cctttggggt gcccaccctc agcctgcagg gcacccggct ggcccatctg       360
     tgggacgatc tgcgggcggt ggcagcagcc accggggtct cggcagaggc agggattgag       420
     gagctacagg gccggctcga gcgggtgcgg cgggctgtgg ctgggcgaaa gcggccccgc       480
     gtggcctttg tggagtggct cgagcccccc tttttaggcg gccactgggt gcccgacctg       540
     gtcgaggccg ccgggggcgc acccttgggg gccagccccg aggcgcccag cttccgcacc       600
     acctgggagg aaatagccgc tttgcagccc gaggtggtgc tgttttcctt ttgcggctac       660
     gggctggaag cagctttgcg ggatctggcg ggctgggcaa accccctgtc cggggtggag       720
     tgctgggccc tggactcggc ctatttttgc gccctgaccc cccaggtggt gcagggggtg       780
     gagattctgg ccgggattct gcaccccggg gcctggccag cgcccgcgcc cgccgaggca       840
     gtgcggaggt ga                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page