(data stored in ACNUC7421 zone)

EMBL: CP001743.PE234

CP001743.PE234       Location/Qualifiers
FT   CDS_pept        207898..208131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0237"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to mitochondrial protein of bilaterial
FT                   origin like (2H598C); SPTR: A1ZF07 Putative orphan protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27016"
FT                   /protein_id="ADD27016.1"
FT                   /translation="MARAELKENVDYYIENGLYVFTADYHRRRGYCCGSRCRHCPYPKE
FT                   IQAQTVQLRLEGRPIKTKEEFEARFGAVLVQP"
     atggccagag cagagctcaa agaaaacgtg gattactaca tcgaaaatgg tctctacgtt        60
     ttcaccgcag actaccaccg gcggcgcggc tactgttgcg gctccaggtg ccgccactgt       120
     ccttacccta aagagattca ggcccagacc gtgcaactgc ggctcgaggg ccgtcccatc       180
     aaaaccaaag aagagttcga ggcgcgtttt ggggcggttc tggtacaacc ttaa             234
//

If you have problems or comments...

PBIL Back to PBIL home page