(data stored in ACNUC7421 zone)

EMBL: CP001743.PE24

CP001743.PE24        Location/Qualifiers
FT   CDS_pept        complement(20909..22066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26806"
FT                   /protein_id="ADD26806.1"
FT                   /translation="MKVMGVHPEVGLLLLAVASGLALCWPARAEPVWRWASLGTLLWGV
FT                   QAAVWLLERQGGLEAPLTPSGVLLFAAALTWAATLRQLPLYEPPRLTLALLPFALAALV
FT                   TALSVLPNRSSQMVWLTDLLPVLLALPLLESALHGQAGESRLIWGLGLIFKAGGSWALA
FT                   LGWPPGGFVYPVWALGFVLIGWGGYLEATEARLGKGLLGFVLGGLLGSLVLLGWPSQVA
FT                   HPFHSMVLVGWGYVVLVTLGGVGWGVYQRIIKAERQLELWINLLESLSSKAQSTQNLTP
FT                   QGVLHSVMEGLQPLYGNLVGIEVRSDVTIRAGQNGPYVYTFELALDTPTEGRLYFSSAP
FT                   KDTRRLEALAPLLTERLRLSLTLNEWRSKAYTDPLTGVLSARCSA"
     atgaaggtga tgggagtaca ccccgaagtc gggctcttgt tgctggctgt tgcctctggt        60
     ctggcgcttt gttggccggc ccgggccgag ccggtctggc gctgggccag tctgggaacg       120
     ctgctctggg gcgtgcaggc tgcggtctgg ctcctcgagc gccagggggg cctcgaggcc       180
     ccgctgacac cctctggcgt cctgctgttc gccgccgcgc tgacctgggc cgccaccctg       240
     cgccaactgc ccctgtacga acccccccgc ctgaccctgg ccctgctacc ctttgcactg       300
     gccgccctgg taactgccct gtctgttctt ccaaaccgct cttctcagat ggtgtggcta       360
     accgacctgc taccggtgct gctggccctg ccccttctag aatcggcttt gcacggacag       420
     gctggtgaaa gccgcctgat ctggggcctg gggctgatct tcaaggccgg gggtagctgg       480
     gccctggcgc tgggctggcc ccccggcggg tttgtgtatc cggtctgggc cctgggcttc       540
     gtgctgatcg gctggggagg ctacctcgag gccaccgagg cccgcctggg caaaggtttg       600
     ctggggtttg tgctgggtgg cttgctgggc agcctggtgc tgctgggatg gccttcccag       660
     gttgcgcacc cgttccacag catggtcttg gtgggatggg gctatgtggt gctggtcacc       720
     ctgggcggcg tgggctgggg ggtctatcag cggattatca aagccgagcg gcagctcgag       780
     ctctggatca acctgctcga gagcctctcc agcaaagccc agtccaccca aaacctcacg       840
     ccccaagggg tgctgcacag cgtgatggag gggctccaac ctctgtacgg caacctggtg       900
     gggatcgagg tgcgctccga cgtaaccatt cgggcagggc agaacggccc ttacgtctat       960
     accttcgagc tggccctgga cacccccacc gagggacggc tttacttctc cagcgcaccc      1020
     aaagacaccc gcaggctgga agccctggcc cccctgctca ccgagcggct gcggctctcc      1080
     ctgaccctca acgaatggcg cagcaaggcc tacaccgacc cgctcaccgg ggttttgagc      1140
     gccagatgca gcgcctga                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page