(data stored in ACNUC7421 zone)

EMBL: CP001743.PE240

CP001743.PE240       Location/Qualifiers
FT   CDS_pept        complement(213995..214639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0244"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; SPTR: A4AKN6
FT                   Rieske iron-sulphur component of ubiQ-cytB reductase;
FT                   InterPro IPR005805:IPR005806; COGs: COG0723 Rieske Fe-S
FT                   protein; KEGG: bra:BRADO3898 hypothetical protein; PFAM:
FT                   Rieske [2Fe-2S] domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27022"
FT                   /protein_id="ADD27022.1"
FT                   /translation="MADHEATAHHHEHHTEDPQAHATRRAILQAAIGVSAGAAVLSTLW
FT                   VGAGLMPREEKIPSKEPVAVGDVLVFATGPKAEQEITLDDLRAAQRERIPFIIAFPKSP
FT                   ENVVKKDLITNTIMVILADPAKMSPETRQHASPEGVLAYSAVCKHLGCTVSLWQNDTWL
FT                   CPCHGGRYDIYNQAKVVGGPVPAPVPQLPVKVEGGKVVVAGEFLGKPGADV"
     atggccgatc atgaagccac tgcccatcac cacgagcacc ataccgaaga cccccaggcc        60
     cacgccaccc gccgggccat cctgcaggcg gccatcggtg tgagcgcagg ggccgcggtg       120
     ctctcgaccc tgtgggtggg tgcgggtctg atgccccgcg aagaaaagat tcccagcaaa       180
     gaaccggtgg cagtgggtga tgtcctggtt tttgccaccg gccccaaagc cgagcaagag       240
     attacgctgg acgacctgcg ggctgctcaa cgggaaagaa tccccttcat catcgctttc       300
     cccaaaagcc ccgagaacgt ggtcaaaaaa gacctgatca ccaacaccat catggtcatc       360
     ctggccgacc cggccaagat gagcccggag acccgccagc acgcctcccc tgaaggggtg       420
     ctggcctact cggcggtctg caaacacctg ggctgtacgg tgagcctgtg gcagaacgac       480
     acctggctct gcccctgcca cggcggccgg tatgacatct acaaccaggc caaggtggtg       540
     gggggccccg tgccggcccc cgttccccaa ctgccggtta aggtggaggg gggcaaggtg       600
     gtggtggcgg gcgagttcct gggcaagccc ggcgccgacg tatag                       645
//

If you have problems or comments...

PBIL Back to PBIL home page