(data stored in ACNUC7421 zone)

EMBL: CP001743.PE241

CP001743.PE241       Location/Qualifiers
FT   CDS_pept        complement(214664..215155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27023"
FT                   /protein_id="ADD27023.1"
FT                   /translation="MYRNDTVVPYFALVFSAALFLMAYLNDRMRVVHEAGVVPHLTVGN
FT                   IGLMAFAMVLFIYGFIGLLSNWLEGSELRPGKHEPEPSSLPMVAGVVLSLLLVMLSGFF
FT                   VRTLVFANNPEIGYYNATTLQAGVFASMMLILALLIAIYKKYFVPEEVLAEDEKSDFPW
FT                   "
     atgtaccgca acgatacggt ggttccctac ttcgccctgg tcttctcagc ggcgttgttt        60
     ctgatggcct acctcaacga ccggatgcgg gtggtgcacg aggccggggt ggtgccccac       120
     ctcacggtgg gcaacatcgg gctgatggcc tttgccatgg tgctgttcat ttatggattt       180
     atcgggctgt tgagcaactg gctcgagggc tccgagctgc gccccggcaa acacgaacct       240
     gagcccagca gcctgccgat ggtggccggg gtggtgctct cgcttctact ggtgatgctc       300
     tcgggcttct tcgtgcgcac tttggtgttc gccaacaacc ccgagattgg ctactacaac       360
     gccaccacct tacaggccgg ggtgtttgcc tcgatgatgc ttatcctggc cctgctcatt       420
     gccatctaca aaaaatactt cgtaccagaa gaagttctgg ctgaggacga gaaaagcgac       480
     ttcccctggt ag                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page