(data stored in ACNUC7421 zone)

EMBL: CP001743.PE242

CP001743.PE242       Location/Qualifiers
FT   CDS_pept        complement(215170..215925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0246"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; SPTR: A6GLS3 Cytochrome
FT                   c oxidase subunit 2; InterPro IPR003088:IPR009056; COGs:
FT                   COG2010 Cytochrome c mono- and diheme variants; KEGG:
FT                   cti:RALTA_A0287 cytochrome c oxidase polypeptide II
FT                   precursor (cytochrome AA3 subunit 2) transmembrane protein;
FT                   PFAM: Cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27024"
FT                   /protein_id="ADD27024.1"
FT                   /translation="MPIERIEVYLDGGAEPVQVLTQPPFKVTYDTRSLSDGEHLLRVVT
FT                   YYTNGAQEVKEVPFKVANTPGVLLQGLEEGKEVSGTLDVTLRVADPDVKPGRERFPGLG
FT                   AAIATAVILGGIWLFFAATGVTNKTLEEVAKPPAAAEAGAHGGDHGGAVAAVDEALKAK
FT                   GEQVYSANCAGCHQPTGKGLPGVFPALDGSKNVADKAYTINILLKGKGGMPSFARLSDE
FT                   ELAAVATYIKNSWSNKFGGVTPDEFKAAR"
     atgccgattg agcgaatcga agtgtatctg gatggcggcg ccgaacctgt gcaggtgctc        60
     acccaacccc ctttcaaagt cacctacgac acccgctcac taagcgatgg ggaacacctg       120
     ctgcgggtgg ttacctacta caccaacggc gcgcaggaag taaaggaagt gccctttaag       180
     gtagccaaca ccccgggggt gctgctgcag ggcctcgagg agggtaagga ggtctcgggc       240
     accctggacg tgaccctgcg ggtggccgac cccgatgtga agcccggccg cgagcgcttc       300
     cccgggctgg gcgcggccat cgccaccgct gtaattctgg gcgggatctg gctcttcttt       360
     gccgcaactg gcgtgaccaa caaaaccctc gaggaagtag ccaaaccccc cgctgccgcc       420
     gaggcagggg cccatggggg cgatcacggc ggggcggtgg cggccgtgga cgaagccctt       480
     aaagccaaag gcgagcaggt ttacagcgcc aactgcgccg gctgccacca gcccaccggc       540
     aagggcctgc cgggggtctt cccggccctg gacggcagca agaacgtggc cgataaggcc       600
     tacaccatca acattctgct caaaggcaag gggggcatgc cctcctttgc ccggctctcc       660
     gatgaggaac tggccgcagt tgccacctat atcaagaata gctggagcaa caagtttggc       720
     ggtgtgacgc ccgacgagtt caaggcggcc cgctaa                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page