(data stored in ACNUC7421 zone)

EMBL: CP001743.PE245

CP001743.PE245       Location/Qualifiers
FT   CDS_pept        complement(218794..219423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27027"
FT                   /protein_id="ADD27027.1"
FT                   /translation="MDKTAQKIIEALSQVVSPLAASSLLKRALGGQSPEALEPQRWAEL
FT                   IEGPLQREIREILPMNGLLPELKQLAQQLKTQARSPQPVAAPTLEVTDLAEYIDLQSES
FT                   ERQRLVLELARKEGVLAVVLESSYGRELRLGAYSEGLADLLSTMHRLLDRKGSYRVFYT
FT                   VFREAQLVLRPLGQGYLAVLTRNEANLGQLLYRMGKIEALQVGAEQ"
     ttggacaaaa ccgcacaaaa aatcatcgag gccctgtccc aggtggtctc gcccctggca        60
     gccagcagcc tgctcaaacg ggcgctgggg gggcagtcgc ccgaggcact ggagccgcag       120
     cgctgggccg aactgatcga ggggccgttg cagcgagaaa tcagagagat cctgccgatg       180
     aatgggcttc tgcccgagct aaagcagttg gctcagcagc tcaaaaccca agcccgcagc       240
     ccccagccag tggcagctcc taccctcgag gtcaccgatc tggccgagta catagacctg       300
     caaagcgagt ccgagcgcca gcgcctggtg ctggaactgg ctcgcaagga gggggtgctg       360
     gcggtggtgc tggagtccag ttacgggcgc gaattgcgcc tgggagctta cagcgagggc       420
     ctggccgatc tgctttctac catgcaccgg ttacttgacc gtaaagggag ttaccgggtg       480
     ttttacactg tgttcaggga ggctcagctg gtgctgcgcc cgttggggca aggctacctg       540
     gctgtgctca cgcgcaacga ggccaatctg gggcaattgc tataccgaat gggcaagatc       600
     gaagccctcc aggtgggcgc tgagcaatag                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page