(data stored in ACNUC7421 zone)

EMBL: CP001743.PE248

CP001743.PE248       Location/Qualifiers
FT   CDS_pept        complement(221637..222092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0252"
FT                   /product="conserved hypothetical protein"
FT                   /note="SPTR: A8J328 S-isoprenylcysteine
FT                   O-methyltransferase; COGs: COG2020 Putative
FT                   protein-S-isoprenylcysteine methyltransferase; KEGG:
FT                   eba:ebD26 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27030"
FT                   /protein_id="ADD27030.1"
FT                   /translation="MRLGERGEGYVVGQFALLGLLVLALWVTPSFSPPWLGGLGRGLAW
FT                   VGLGVLLLAAWQLGRNLTALPKPRPGGYLVQQGLYRVVRHPIYCGVLLWALGSSLAHLN
FT                   LWTLLLCGLLFVWLDRKASLEETWLQERFPGYSAYRQRVKKLIPWVY"
     atgcgcctgg gcgagcgggg cgaggggtat gtggtggggc agtttgccct gctgggcctg        60
     ctggtgctgg ctttgtgggt tacgccttcc tttagcccgc cctggctggg ggggctgggg       120
     cgggggctgg cctgggtggg gctgggggtg ctgctgctgg cggcctggca actgggccgc       180
     aacctgaccg ccctgcccaa acccaggccg gggggctacc tggtacagca ggggctctac       240
     cgggtggtgc ggcatcccat ctactgcggg gtgctgctgt gggcgctggg cagcagcctg       300
     gcccatctga acctctggac gcttctgctg tgtgggctgc tgtttgtctg gctcgaccgc       360
     aaggccagcc tcgaggaaac ctggcttcaa gagcgcttcc ccgggtacag cgcctatcgc       420
     caacgggtca aaaagctgat tccctgggtc tactag                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page